.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e0z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function (RER070207001348) from Eubacterium rectale at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3e0z Target Id 388609
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS17962,YP_002936966.1, RER070207001348, 89024 Molecular Weight 12463.56 Da.
    Residues 108 Isoelectric Point 4.86
    Sequence mitsiarqsiilkclrqksvlvsnyelyytaglakkcfgiavdadmepkqlleelqkhidkvspadeqe kylihllgnyepddthdeqtvelfhmgeteehiwqvsit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.75 Rfree 0.219
    Matthews' coefficent 1.82 Rfactor 0.171
    Waters 394 Solvent Content 32.45

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The EUBREC_1070 gene from Eubacterium rectale encodes the YP_002936966 amino acid sequence, a protein of unknown function. The sequence is not in PfamA and does not give any strong hits in remote homology detection servers such as HHPred or FFAS. ZP_04742165, a protein with 50% identity to this target, is annotated as putative imidazole glycerol phosphate synthase subunit HisF.

    Similarly, 3e0z does not provide any significant hits in structural similarity searches (DALI top hit is a phosphatase (PDB id: 1LAR) with Z-score 3.7 and 10% seq.id.; FATCAT top hit is a transcription associated factor (PDB id: 1H3O) with P-value 3.34e-03).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch