.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e8o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_295823.1) from DEINOCOCCUS RADIODURANS at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 3e8o Target Id 390777
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS14623,NP_295823.1, 3.30.70.900, 85707 Molecular Weight 12893.02 Da.
    Residues 118 Isoelectric Point 6.00
    Sequence mspqsmltspqhprrttmvishgtlsasaehaahlrqllvhiaqatrqedgcllylvsedlsqpghfli tehwdnlgamhthlalpgvtqaidalkhlnvtdlkitayeageainimg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.163
    Matthews' coefficent 1.79 Rfactor 0.128
    Waters 277 Solvent Content 31.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e8o
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Modeling discrete heterogeneity in X-ray diffraction data by fitting multi-conformers
    H Van Den Bedem, A Dhanik, JC Latombe - Section D: Biological , 2009 - scripts.iucr.org
     
    3. A novel approach to studying the structural and functional properties of proteins with unknown functions
    MA Gorbacheva, AG Yarosh, PV Dorovatovskii - Russian Journal of , 2012 - Springer
     

    Protein Summary

    Protein of unknown function with ferredoxin-like fold (GenBank: NP_295823.1) isan uncharacterized protein that belongs to PFAM PF03992. This is the antibiotic biosynthesis monooxygenase family, and this domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species.

    MG14516A_dimer.png

    Fig 1. The protein is dimeric in organization with the two monomers forming a barrel. The last strand of each monomer extends to the other in the dimerization process.

        

    There are numerous structural homologs of this protein. Fig 2. shows teh superposition of some of these proteins.

    all.png

    Fig 2. Superposition of structural homologs: this target (green), 1tuv (cyan), 1x7v (magenta), 1y0h (yellow), 2fb0 (pink), 2gff (grey), 2omo (blue), 2pd1 (orange), 3bm7 (lime).

    all_as.png UNL_DM.png

                                  A                                                                                        B 

    Fig 3. A. Some of these proteins have some ligands bound in the core of the protein suggesting the location of the active site. B. An unknown ligand (UNL) (shown as red spheres) has been modeled in the unbiased density (DM density prior to model building) in this region in this protein (green). Structure 1tuv (cyan) has been superimposed on the target to show the binding of the ligand VK3 (shown in sticks) in 1tuv at the same site.

    Ligand Summary

    Unknown ligand (UNL)

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch