.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ec9

    Table of contents
    1. 1. Protein Summary
      1. 1.1. References:
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 3ec9 Target Id 390600
    Molecular Characteristics
    Source Burkholderia thailandensis e264
    Alias Ids TPS14586,YP_440611.1, 3.10.450.50, 382589 Molecular Weight 15741.90 Da.
    Residues 139 Isoelectric Point 5.61
    Sequence mrnpsedhmmrtpyqivadhyaasdrhdpaammadiapaiewtemagfpcagtyrsadeivrnvfrrlg eewdgytfkldalhdagdtvigvgrysgtyrrtgksfecrvahvwrvdagkivhfeqftdtllvaqamqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.198
    Matthews' coefficent 2.33 Rfactor 0.168
    Waters 371 Solvent Content 47.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene BTH_I0051 from Burkholderia thailandensis (strain E264) encodes the YP_440611 amino acid sequence that folds into an alpha and beta class protein that belongs to the SCOP NTF2-like superfamily (Fig 1). Genome context analysis suggests a functional linkage, based on neighborhood, with the oxidoreductase BTH_I0053 (score 0.725).

     

    According to DALI, 3ec9 is structurally similar to 1tuh (BAL32A, Z=7.1%, RMSD=1.96A, 19% seqid), and 1oh0 (ketosteroid isomerase, Z=6.1%, RMSD=2.03A, 15% sedid).  However, the active site residues of 1oh0 are not conserved in the 3ec9 structure.

        

    The structure contains a  SnoaL-like domain -- Rob Finn (PFAM)

    dimer_asu_90907.png

     Fig 1. 3ec9 structure contains one biological dimer in asu.

    super_1tuh_1oh0.png

     Fig 2. Superposition of 3ec9 (green), 1tuh (grey) and 1oh0 (light pink) structures. The ligand (EQU; equilenin) bound in the active site of 1oh0 is shown as stick. 3ec9 does not contain any ligand in this region.

        

    References:

    Robinson, A.,  Wu, P.S.-C.,  Harrop, S.J.,  Schaeffer, P.M.,  Dosztanyi, Z.,  Gillings, M.R.,  Holmes, A.J.,  Nevalainen, K.M.H.,  Stokes, H.W.,  Otting, G.,  Dixon, N.E.,  Curmi, P.M.G.,  Mabbutt, B.C.  (2005) Integron-associated Mobile Gene Cassettes Code for Folded Proteins: The Structure of Bal32a, a New Member of the Adaptable alpha+beta Barrel Family  J.Mol.Biol. 346: 1229-1241

    Kim, S.W.,  Cha, S.S.,  Cho, H.S.,  Kim, J.S.,  Ha, N.C.,  Cho, M.J.,  Joo, S.,  Kim, K.K.,  Choi, K.Y.,  Oh, B.H.  (1997) High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue.  Biochemistry 36: 14030-14036

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch