The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative methyltransferase from antibiotic biosynthesis pathway (YP_324569.1) from ANABAENA VARIABILIS ATCC 29413 at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3ege Target Id 383250
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS7398,YP_324569.1, 88593 Molecular Weight 29653.49 Da.
    Residues 260 Isoelectric Point 5.51
    Sequence msiynsigkqysqtrvpdirivnaiinllnlpkgsviadigagtggysvalanqglfvyavepsivmrq qavvhpqvewftgyaenlalpdksvdgvisilaihhfshleksfqemqriirdgtivlltfdirlaqri wlydyfpflwedalrflpldeqinllqentkrrveaipfllphdlsdlfaaaawrrpelylkaevragi ssfalanqdlvekglelltadlnngewirkygeihhlqeidigyrfiyttldk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.202
    Matthews' coefficent 3.82 Rfactor 0.182
    Waters 124 Solvent Content 67.81

    Ligand Information



    Protein Summary

    This is a putative MerR-family transcriptional regulator protein from Anabaena variabilis ATCC 29413.

    It belongs to PFAM PF08241 on the basis of the sequence residues 38-127.

    Members of this family are SAM dependent methyltransferases. In addition, residues 141-259 correspond to PfamB PB043559.

    The protein is shown below and assembles as a monomer in solution.



    There are a few structural homologs of this protein, most notably 2yqz and 2yr0. A superposition of this protein (green) on the homologs [1xxl (cyan), 2gs9 (magenta), 2p35 (yellow), 2yqz (pink), 2yr0 (grey), 3ccf (blue)] is shown below.


    There are many other homologs listed by  FFAS.

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    130.96 kB18:23, 25 Aug 2008abhinavkActions
    No description
    300.14 kB18:23, 25 Aug 2008abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch