The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TetR-family transcriptional regulator (NP_070644.1) from ARCHAEOGLOBUS FULGIDUS at 2.55 A resolution. To be published
    Site JCSG
    PDB Id 3egq Target Id 383741
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS7438,NP_070644.1, 92585 Molecular Weight 19916.17 Da.
    Residues 169 Isoelectric Point 5.54
    Sequence mtdqsvriieaalrlymkkpphevsieeiareakvskslifyhfeskqklleeavmhafrkmmeefnpr sveevvdygigfiaerrefiefmmyalsqvrieelermfgealekvaslfegcrhpretaialmamldg lsiyslyfdlgklekyreiamefvesrrvra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.275
    Matthews' coefficent 2.35 Rfactor 0.243
    Waters 9 Solvent Content 47.72

    Ligand Information



    Protein Summary

    Gene AF_1817 from ARCHAEOGLOBUS FULGIDUS encodes the NP_070644 protein that belongs to the bacterial regulatory protein tetR family (PF00440). Analysis of its genome context indicates a possible functional link (score 0.87) with the AF_1819 gene, an ABC transporter, ATP-binding protein.  

    Pre-SCOP classifies 3egq in the all alpha class, homeodomain-like superfamily, tetracyclin repressor-like, N-terminal domain family. A FFAS search suggests that 3egq is structurally similar to PDB:2f07, PDB:2ccy.  The SSM server also suggests that this target is similar to PDB:3crj, PDB:2np5, PDB:2zcn, PDB:2dg8, PDB:2nx4 and PDB:1zk8. DALI top hits are with PDB:3crj, PDB:2dg8, PDB:3kkd and PDB:2np5 (Z=15). All of these structures are transcriptional regulatory protein. A PEG molecule is modeled in the putative active site in each subunit. 3egq crystal structure presents two subunits in each asymmetric unit.  The interface interaction calculation suggests the biomolecule may be a dimer in solution.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch