The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phenylacetate-CoA oxygenase subunit PaaB (YP_297411.1) from RALSTONIA EUTROPHA JMP134 at 2.65 A resolution. To be published
    Site JCSG
    PDB Id 3egr Target Id 389767
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS7627,YP_297411.1, PF06243, 85335 Molecular Weight 11045.00 Da.
    Residues 95 Isoelectric Point 6.03
    Sequence mtqkewplwevfvrskqglehkhcgslhatdaqqalhmardvytrrqegvsiwvvpstaitasapeekp elfdpmadkiyrhptfyqlpdevnhm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.226
    Matthews' coefficent 3.18 Rfactor 0.188
    Waters 58 Solvent Content 61.37

    Ligand Information



    Protein Summary

    Reut_A2307 (YP_297411.1) from Ralstonia eutropha (strain JMP134) (Alcaligenes eutrophus)
    belongs to the Pfam family PaaB (PF06243), and this is the first crystal structure in this Pfam family.
    PaaB comprised of Phenylacetic acid degradation B protein thought to be part of a multicomponent oxygenase
    involved in phenylacetyl-CoA hydroxylation.

    There are 2 molecules per asymetric unit of the unit cell but the crystal
    packing analysis suggests that the biological unit should be a tetramer.



    Fig 1. The crystal structure of YP_297411.1 in asu. Two molecules
    are in asu (A: sky blue, B:pink).


    YP_297411.1 is structurally similar to 1vq3 (Z=4.9, rmsd 2.6A, %id=8) from DALI search.
    However, 1vq3 contains extra domains in N-terminal.



    Fig 2. Superposition PK6406E (green) to 1vq3(cyan). 1vq3 contains extra
    domain in the N-terminal.


    Ligand Summary




    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch