.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eo6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function (DUF1255) (AFE_2634) from ACIDITHIOBACILLUS FERROOXIDANS NCIB8455 at 0.97 A resolution. To be published
    Site JCSG
    PDB Id 3eo6 Target Id 391572
    Molecular Characteristics
    Source Acidithiobacillus ferrooxidans atcc 23270
    Alias Ids TPS14634,AFE_2634, 2.60.120.10, 88996 Molecular Weight 11374.17 Da.
    Residues 105 Isoelectric Point 4.96
    Sequence mapdqqvpatalgkssrisldgrrsersviladgsmhsltllhpgvytlssevaetirvlsgmayyhae gandvqelhagdsmvipanqsyrlevmepldyllss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 0.97 Rfree 0.143
    Matthews' coefficent 2.08 Rfactor 0.123
    Waters 454 Solvent Content 40.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eo6
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Modeling discrete heterogeneity in X-ray diffraction data by fitting multi-conformers
    H Van Den Bedem, A Dhanik, JC Latombe - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    391572 is a small protein with cupin fold  but unknown function. It is an all beta protein. The structure was refined to sub 1A resolution (0.97A). It probably functions as a dimer (but the dimer interface is not very extensive, Figure 1). A potential active site near the dimer interface can be identified through the analysis of sequence conservation (Figure 2), the highly conserved residues at this site include, Arg17, Ser38, Arg24, Thr40,  Ser51, Glu55, etc. The function of this protein is unknown since cupin fold supports a variety of biological functions. Based on the active site configuration, it is probably an enzyme.

      

    Figure 1. putative dimer of 391572

    mg16648a-dimer.png

    Figure 2. putative active site identified by Consurf

    mg16648a-consurf.png

    References

    Dunwell JM; , Biotechnol Genet Eng Rev 1998;15:1-32.: Cupins: a new superfamily of functionally diverse proteins that include germins and plant storage proteins

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     mg16648a-consurf.png
    putative active site identified by consurf
    114.97 kB20:33, 5 Sep 2008qxuActions
     mg16648a-dimer.png
    putative dimer of 391572
    71.82 kB20:10, 5 Sep 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch