The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Protein of unknown function (DUF861) with a RmlC-like cupin fold (17741406) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.64 A resolution. To be published
    Site JCSG
    PDB Id 3es4 Target Id 390432
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS14568,17741406,, 88958 Molecular Weight 12510.55 Da.
    Residues 115 Isoelectric Point 4.41
    Sequence mtmpifnisddvdlvpampaegrdggsyrrqiwqddvengtivavwmaepgiynyagrdleetfvvveg ealysqadadpvkigpgsivsiakgvpsrleilssfrklatvipkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.64 Rfree 0.160
    Matthews' coefficent 2.84 Rfactor 0.142
    Waters 302 Solvent Content 56.74

    Ligand Information



    Protein Summary

    Pfam update:This matches the Pfam family Cupin_3 (PF05899). It is not the first structure of the family.


    390432 shares sequence similartiy with the Cupin_3 in Pfam. This family contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria. The function of this family is unknown. 390432 contains two protomers in the asymmetric unitof the unit cell that form a dimer as shown below. Crystal packing analysis using PISA suggest that this dimer should be the stable oligomeric form in solution.


    390432 is tructually similar to many either uncharacterized protein or hypothetical protein including JCSG targets of Cupin 2 (PDB code= 2pfw; rmsd=1.9A aligned Ca, 12% seq id, and 2ozj; rmsd=2ozj, rmsd=2.3A aligned Ca, 10% seq id). The superposition as shown below indicates that their olygomerization between 390432 (green) and 2pfw (cyan) is similar. in contrast, the dimerization mode of 2ozj (pink) is different.




    1. Dunwell JM; , Biotechnol Genet Eng Rev 1998;15:1-32.: Cupins: a new superfamily of functionally diverse proteins that include germins and plant storage proteins.

    Ligand Summary




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch