.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f0h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Aminotransferase (RER070207000802) from Eubacterium rectale at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3f0h Target Id 391588
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS14635,YP_002938516.1, 3.40.640.10, 85503 Molecular Weight 39676.69 Da.
    Residues 357 Isoelectric Point 5.76
    Sequence mlnftvgpvmsseevraigaeqvpyfrttefsstmlenekfmleyakapegskavfmtcsstgsmeavv mncftkkdkvlvidggsfghrfvqlceiheipyvalklehgkkltkeklyeydnqnftgllvnvdetst avlydtmmigefckknnmffvcdcvsafladpfnmnecgadvmitgsqkvlacppgisvivlaprgver vekskvrtmyfdlkdalknqergqtpftpavgillqinerlkeikkhggadaevariasqaadfrakik dlpfelvsespangvtsvhpttanaydiflklkdeygiwicpnggemkdtifrvghigalthednttlv nafkdlqkrnll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.167
    Matthews' coefficent 2.45 Rfactor 0.147
    Waters 379 Solvent Content 49.73

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    391588 belongs to aminotransferase class V (PF00266). 391588 is very likely to function as a dimer since the active site is located near the dimer interface. The structure is very similar to the PH1308 protein from Pyrococcus horikoshii OT3 (PDB code: 2dr1, TOPSAN page, 1.53A for 353 aligned Ca atoms, 25% sequence idenitity), alanine-pyruvate aminotransferase with 2-methylserine from Thermus thermophilus (PDB code: 2yri, TOPSAN page, 1.63A for 345 Ca), and several other aminotransferases including proteins from the Cystathionine synthase-like family from SCOP. The highly conserved active sites suggest that 391588 is functionally similar. The UNL ligand is somewhat similar to the MMM in 2yri.

     

    Figure 1. 391588 monomer

    monomer-mg1400b.png

     Figure 2. Dimer of 391588 with Lys187-PLP (LLP187) shown as red sticks

    dimer.png

     Figure 3. The PLP is covalently attached to Lys187. An UNL is attached to C4A atom of PLP. 

    coot.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     coot.png
    PLP with UNL
    1835.93 kB18:08, 20 Oct 2008qxuActions
     dimer.png
    dimer of 391588 with LLP shown as red sticks
    165.75 kB18:15, 20 Oct 2008qxuActions
     monomer-mg1400b.png
    monomer of 391588
    116.89 kB19:15, 20 Oct 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch