.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f44

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative monooxygenase (YP_193413.1) from Lactobacillus acidophilus NCFM at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3f44 Target Id 391715
    Molecular Characteristics
    Source Lactobacillus acidophilus ncfm
    Alias Ids TPS18380,YP_193413.1, 3.30.70.900, 85283 Molecular Weight 24827.53 Da.
    Residues 219 Isoelectric Point 4.85
    Sequence mdetpifkikkltiaendrseyiryaeknmhdsipaeegtlligsghddahgednyeievfrnkgaedl hiagshaddfvetvnkiatkqkvidlhpevittkaqralnsyadnfvmrlikvevkdadaekfshavkk emttsmasepgmeimmsgtnidnpnewyfievyandeaydihvktphykeyieetdgmvksrdvktlvr dtlatqgaivld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.199
    Matthews' coefficent 2.16 Rfactor 0.177
    Waters 219 Solvent Content 43.05

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f44
    1. Metagenomics and the protein universe
    A Godzik - Current opinion in structural biology, 2011 - Elsevier
     

    Protein Summary

    This target is annotated as a hypothetical protein. It belongs to PFAM PF03992 which is a family of monooxygenases involved in the biosynthesis of several antibiotics. Some of the sequence homologs of this protein are monooxygenases too. This suggests this protein could have this function.

     

    The protein comprises of a repeat of a single domain in a manner such that the sheets for a central barrel core.

    MG8150B.png

    This is very similar to another JCSG structure 391426 in which the repeating domains are independent chains. Indeed, there are several examples where the repeating domain is an idependent chain, as shown below (target in green, 2bbe (cyan),  2gff (yellow), 3bm7 (grey)).
     

    MG8150B_2bbe_2gff_3bm7.png

    On the other hand there are proteins with two repeating domain as found in this target, shown below, target in green, and 2pgc in pink.

    MG8150B_2pgc.png
     

    References:

    Yeats C, Bentley S, Bateman A; , BMC Microbiol 2003;3:3-3.: New Knowledge from Old: In silico discovery of novel protein domains in Streptomyces coelicolor.  PUBMED:12625841
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch