.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f7s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function (NP_746665.1) from PSEUDOMONAS PUTIDA KT2440 at 2.11 A resolution. To be published
    Site JCSG
    PDB Id 3f7s Target Id 391198
    Molecular Characteristics
    Source Pseudomonas putida kt2440
    Alias Ids TPS20205,NP_746665.1, 3.10.450.50, 87407 Molecular Weight 15860.29 Da.
    Residues 141 Isoelectric Point 5.23
    Sequence mstaaeseirqlierwmqavrdrdipgiiapyaddivafdaiqalqfkgksaytahwemcmgmctgpmv felaqltvhaagdlalahwlnrcgpgddesqcgfmratvgyrrqggqwqvihehwsapfdmetqkalfd lkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.11 Rfree 0.217
    Matthews' coefficent 2.98 Rfactor 0.177
    Waters 65 Solvent Content 58.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f7s
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene PP4556 from Pseudomonas putida kt2440 encodes the NP_746665 protein that belongs to the Ca-calmodulin dependent kinase II association domain group (PF08332). FIGfam annotates PP4556 as a ketosteroid isomerase homologue (NP_746665 shows 44% seq. id. with YP_001170697).

    Pre-SCOP classifies 3f7s in the NTF2-like superfamily. 3f7s structure is similar to another jcsg structure 3cnx (rmsd 1.56 for 119 aligned Ca atoms). The 3f7s crystal contains a monomer in the asu, the dimer is formed through crystallographic 2-fold axis. This structure does not contain the E109/H150/C59 putative triad. An unknown ligand (UNL) is located at a similar position as in 3cnx. There are some shifts between the 3f7s and the 3cnx dimers.


    Figure 1. monomer of  3f7s

    mg5690c.png

    Figure 2. dimer of 3f7s

    mg5690c-dimer.png

    Figure 3. The unknown ligand in the putative active site of 3f7s (solomon map)

    mg5690c-coot.png

    References

    Hoelz, A.,  Nairn, A.C.,  Kuriyan, J. (2003) Crystal structure of a tetradecameric assembly of the association domain of Ca2+/calmodulin-dependent kinase II. Mol.Cell 11: 1241-1251

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     mg5690c-coot.png
    UNL in mg5690c
    1419.01 kB23:11, 29 Oct 2008qxuActions
     mg5690c-dimer.png
    dimer of mg5690c
    112.6 kB18:26, 29 Oct 2008qxuActions
     mg5690c.png
    monomer of MG5690c
    86.87 kB18:26, 29 Oct 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch