.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f8x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative delta-5-3-ketosteroid isomerase (YP_050331.1) from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3f8x Target Id 390788
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS14624,YP_050331.1, 3.10.450.50, 85559 Molecular Weight 16244.55 Da.
    Residues 147 Isoelectric Point 4.71
    Sequence mskveqnaqhniqqtspnaavqsglqewhriiaeadwerlpdllaedvvfsnpstfdpyhgkgplmvil pavfsvlenfqyarhfssksgyvlefnanmgdelltgvdliefndagkitdlvvmmrpasvvidlsvev gkriaaaqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.55 Rfree 0.18810
    Matthews' coefficent 2.26 Rfactor 0.15822
    Waters 791 Solvent Content 45.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f8x
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

     

    Pfam update: this target has been incorporated into family PF12680: SnoaL_2

     

    YP_050331.1 encodes a protein with 147 residues from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043.  The search results from NCBI sequence alignment can not suggest any putative conserved domain other than hypothetic protein. The SSM structural comparison reveals that this protein carries an α/β-barrel similar to the NTF-2 domain.  This target should be structurally related to PDB:1TUH, PDB:1W02 and PDB:1OH0.  Slightly differing from these homologous structures, there is a long c-terminal helix in the protein structure of YP_050331.1. This target is packed in P1 space group with four subunits in each asymmetric unit.  The interface interaction suggests that the biomolecule of YP_050331.1 be a dimer.

      

      

    390788_3.png

      

    Figure 1. Protein YP_050331.1 carries an α/β-barrel similar to the NTF-2 domain with an additional helix at the C-terminals.  

      

      

      

    390788_2.png

      

    Figure 2. The biomolecule of YP_050331.1 should be a dimer based on interface interaction.

      

    390788_4.png

      

     Figure 3.  Protein YP_050331.1 (green) is structural homolog to 1TUH, 1W02 and 1OH0.

      

      

    Refrences,

     1.    Robinson, A.,  Wu, P.S.-C.,  Harrop, S.J.,  Schaeffer, P.M.,  Dosztanyi, Z.,  Gillings, M.R.,  Holmes, A.J.,  Nevalainen, K.M.H.,  Stokes, H.W.,  Otting, G.,  Dixon, N.E.,  Curmi, P.M.G.,  Mabbutt, B.C.  (2005) Integron-associated Mobile Gene Cassettes Code for Folded Proteins: The Structure of Bal32a, a New Member of the Adaptable alpha+beta Barrel Family  J.Mol.Biol.   346: 1229-1241   (PDB ID: 1TUH)

    2.    Primary Citation       Jang, D.S.,  Cha, H.J.,  Cha, S.S.,  Hong, B.H.,  Ha, N.C.,  Lee, J.Y.,  Oh, B.H.,  Lee, H.S.,  Choi, K.Y.  (2004) Structural double-mutant cycle analysis of a hydrogen bond network in ketosteroid isomerase from Pseudomonas putida biotype B.  Biochem.J.   382: 967-973   (PDB ID: 1W02)

    3.    Kim, S.W.,  Cha, S.S.,  Cho, H.S.,  Kim, J.S.,  Ha, N.C.,  Cho, M.J.,  Joo, S.,  Kim, K.K.,  Choi, K.Y.,  Oh, B.H.   (1997) High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue.  Biochemistry   36: 14030-14036   (PDB ID: 1OH0).
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch