.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fdh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SusD homolog (NP_810946.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.75 A resolution. To be Published
    Site JCSG
    PDB Id 3fdh Target Id 393011
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS20285,NP_810946.1, BIG_773, 324973 Molecular Weight 54877.63 Da.
    Residues 498 Isoelectric Point 4.72
    Sequence sedtmdrinkdhdhttsvasrfiladvitstafsnasgdintyassyieyevgvdnqlyyaevreneps ssstfnnswngiysslknariiidqcgeggrdhgndvtrgmaevmaayncaliadffgdapcsqaalvd ekgspvymtpkmdtqqeiytqiisylddaianlqkedladvteqdflyagdadkwlkfayglkarytmr linrssnksadyekvldyvsksftsaddqaafdiydsnninpfygfynsragfgastslgtkllayndp ranrafftpivdkkrsqvaandpslvpapngspdqstskygisafvyaktaptllmsyhelmflkaeal crlnrdaedalkeavvagllnaensisiaikelgsglntnssevitetsagkyfddvvkakyaanplqe tmiqkylamwgasgeatetyndfrrmkglnenfitltnpnnsskfplrypygnsdtaanpevkaaygng dyvysepvwwaggsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.189
    Matthews' coefficent 2.62 Rfactor 0.158
    Waters 643 Solvent Content 53.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fdh
    1. Structure of BT_3984, a member of the SusD/RagB family of nutrient-binding molecules
    C Bakolitsa, Q Xu, CL Rife, P Abdubek - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Bacteroides thetaiotaomicron gene BT_2033 (aka JCSG target 393011, translated to NP_810946.1) is a member of a SusD/RagB family PF07980 of outer membrane nutrient receptors, and is homologous to two other recently solved JCSG structures (3ejn, 3cgh) and to the B. thetaiotamicron SusD (PDB:3ck7)). Exact function of BT_2033 is uknown, but it is likely to be involved in nutrient, most likely polysacharides, binding and utilization, as are all others Bacteroides SusD homologs. BT_2033 is likely to form a complex with its genomic neighbor, BT_2032, which is a SusC-homolog. SusC/SusD pairs are always conserved element of polysaccharide utilization loci (PULs) in Bacteroides. BT_2033/BT_2032 pair forms an unusually short PUL, containing only these two proteins.

     

    A superposition of these structures are shown below [target (green), 3cgh (cyan), 3ejn (magenta)].

    all.png

     

    BT_2033 occurs as a monomer in the crystal structure, which is likely different from its biological form where it  probably forms a complex with its genomic neighbor, SusC homolog BT_2032, as do all known SusC/SusD pairs. It should be noted that the first 22 residues at the N-terminus, which form a membrane anchor, were omitted from the construct.

    As other SusD homologs, BT_2033 consists of two domains, both helical. An N-terminal half of BT_2033 consists of several TRP-like repeats which support the helical, substrate binding C-terminal domain with a novel fold.

    GS13599A.png
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     all.png
    No description
    229.5 kB18:59, 18 Nov 2008abhinavkActions
     GS13599A.png
    No description
    112.9 kB18:59, 18 Nov 2008abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch