.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fjs

    Title Crystal structure of protein of unknown function with RmlC-like cupin fold (YP_298287.1) from RALSTONIA EUTROPHA JMP134 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3fjs Target Id 391247
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS18342,YP_298287.1, 2.60.120.10, 87420 Molecular Weight 11761.87 Da.
    Residues 113 Isoelectric Point 6.16
    Sequence mslphlssgevasvlplgkqltqtpsaalfkehrlevmrmvlpagkqvgshsvagpstiqclegeveig vdgaqrrlhqgdllylgagaahdvnaitntsllvtvvlvdrggs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.217
    Matthews' coefficent 2.05 Rfactor 0.179
    Waters 233 Solvent Content 40.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fjs
    1. HP0902 from Helicobacter pylori is a thermostable, dimeric protein belonging to an all-_ topology of the cupin superfamily
    DW Sim, YS Lee, JH Kim, MD Seo, BJ Lee, HS Won - proteins, 2009 - jbmb.or.kr
     

    Protein Summary

    The protein encoded by Reut_B4087 (YP_298287.1) belongs to PFAM PF07883 and contains a cupin domain (residues 38-107). This family represents the conserved barrel domain of the SCOP 'RmlC-like cupins' superfamily.

    The monomer structure of 3fjs, as shown below, consists largely of beta-strands. 3fjs crystal structure is, however, a dimer and could represent the solution state of the protein.

    MG14627A_monomer.pngMG14627A_dimer.png

                          Monomer                                                                               Dimer

     

    There are a large number of structural homologs of 3fjs. The top ten of these, as sorted by Z-score from a dali search hit, are listed below in the table.

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID TITLE
    1 1yhf 14.2 2.5 100 114 25 HYPOTHETICAL PROTEIN SPY1581
    2 2ozj 14.0 2.5 98 109 18 CUPIN 2, CONSERVED BARREL
    3 2q30 13.7 2.2 96 106 25 UNCHARACTERIZED PROTEIN
    4 1v70 13.4 1.9 94 105 23 PROBABLE ANTIBIOTICS SYNTHESIS PROTEIN
    5 2opk 12.8 2.0 94 111 17 HYPOTHETICAL PROTEIN
    6 2dct 12.8 2.0 94 105 23 HYPOTHETICAL PROTEIN TTHA0104
    7 2b8m 12.8 2.5 97 109 14 HYPOTHETICAL PROTEIN MJ0764
    8 2pfw 12.7 1.9 91 112 20 CUPIN 2, CONSERVED BARREL DOMAIN PROTEIN
    9 2oa2 12.7 1.8 99 132 16 BH2720 PROTEIN
    10 3d82 12.5 2.9 96 101 10 CUPIN 2, CONSERVED BARREL DOMAIN PROTEIN

     

    A superposition of these structures are shown below. The color scheme used in the figure is 3fjs (green), 1o4t (cyan), 1v70 (lightmagenta), 1yhf (yellow), 2b8m (salmon), 2dct (lightgrey), 2gu9 (slate), 2ilb (orange), 2oa2 (lime), 2opk (deepteal), 2ozj (hotpink), 2pfw (yelloworange), 2q30 (violetpurple), 2vpv (grey70), 3d82 (marine).

    all.png

     

    References:

    • Dunwell JM; , Biotechnol Genet Eng Rev 1998;15:1-32.: Cupins: a new superfamily of functionally diverse proteins that include germins and plant storage proteins. PUBMED:9573603
    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch