.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g16

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function with cystatin-like fold (YP_001022489.1) from METHYLOBIUM PETROLEOPHILUM PM1 at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 3g16 Target Id 391024
    Molecular Characteristics
    Source Methylibium petroleiphilum pm1
    Alias Ids TPS20868,YP_001022489.1, 3.10.450.50, 325168 Molecular Weight 17205.49 Da.
    Residues 155 Isoelectric Point 5.64
    Sequence mtaptlsraamekvirtyydgcneadeakmiacfvpeavhyfpagmyggafrgaaqiahrwrtavetlg sywtidalvidaetaeaaiewthfktnqdkvlrgaecvefdrasglireirafyaspqaegiarlelgd fdyagrgyrvtsprkpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.167
    Matthews' coefficent 2.56 Rfactor 0.148
    Waters 391 Solvent Content 51.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3g16
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Pfam update: This overlaps with the relatively new family SnoaL_2 of proteins, sharing the SnoaL fold..

    The crystal structure reveals it to be a ketosteroid isomerase-like protein.

    It is present as a dimer in the crystal structure and crystal packing analysis suggests that this dimer should be the stable oligomeric form in solution. An unidentified ligand (UNL, orange spheres) has been modeled at the putative active site in both protomers. It is possible that this UNL is actually a MES molecule from the crystallization buffer (see ligand summary below).

    Fig1.jpg

    The final UNL superimposed on a Fo-Fc omit electron density map (green) is shown here:

    Fig2.jpg

    There are numerous interesting residues (green sticks) in this putative active site around the UNL which could be

    functionally important. They are: Tyr18, Tyr19, Cys22, His40, Phe42, Tyr47, Trp61, Trp72, Trp90, His92, Glu105 and Tyr123.

    Fig3.jpg

     

    Other protein structures that are most similar in structure (by SSM at EBI) to this protein are (PDB ids): 1tuh, 2z77, 1w02, 1e97, etc. These are ketosteroid isomerase like proteins. Other similar proteins based on sequence can be found via the BLAST and FFAS links above and conserved residues can be seen.

    Tyr18 is found to be conserved in several of these other proteins.

    Ligand Summary

    UNL (Unidentified Ligand) at the putative active site.

    It is possible that this UNL is actually a partially occupied MES from the crystallization buffer.

    THIS INFERENCE IS BASED ON THE LOWER B-FACTOR OF ATOM O7 OF UNL-1 WHICH
    SUGGESTS THAT THIS MAY BE A HEAVIER ATOM (LIKE SULFUR).

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
     Fig1.jpg
    No description
    112.91 kB01:09, 2 Dec 2008debanuActions
     Fig2.jpg
    No description
    154.75 kB01:09, 2 Dec 2008debanuActions
     Fig3.jpg
    No description
    127.41 kB01:09, 2 Dec 2008debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch