.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gb0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aminopeptidase PepT (NP_980509.1) from Bacillus cereus ATCC 10987 at 2.04 A resolution. To be published
    Site JCSG
    PDB Id 3gb0 Target Id 375071
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS6829,NP_980509.1, 3.40.630.10, 285374 Molecular Weight 39575.00 Da.
    Residues 372 Isoelectric Point 5.09
    Sequence minqerlvnefmelvqvdsetkfeaeickvltkkftdlgvevfeddtmavtghgagnlictlpatkdgv dtiyftshmdtvvpgngikpsikdgyivsdgttilgaddkaglasmfeairvlkekniphgtiefiitv geesglvgakaldreritakygyaldsdgkvgeivvaaptqakvnaiirgktahagvapekgvsaitia akaiakmplgridsettanigrfeggtqtnivcdhvqifaearslinekmeaqvakmkeafettakemg ghadvevnvmypgfkfadgdhvvevakraaekigrtpslhqsgggsdanviaghgiptvnlavgyeeih ttnekipveelaktaelvvaiieevak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.212
    Matthews' coefficent 2.63 Rfactor 0.169
    Waters 216 Solvent Content 53.18

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gb0
    1. Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate
    AT Brunger, D Das, AM Deacon, J Grant - Section D: Biological , 2012 - scripts.iucr.org
     
    2. Mutational and structural analysis of LN-carbamoylase: new insights into a peptidase M20/M25/M40 family member.
    S Martnez-Rodrguez, A Garca-Pino - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary

    This protein is annotated as a peptidase. It belongs to the CATH family of zinc peptidases. It has two domains that are structurally conserved amongst similar proteins, the peptidase domain and the dimerization domain. The putative active site (black sticks) in the peptidase domain is shown with two bound water molecules:

    Fig1.png

    Crystal packing analysis suggests that the protein should dimerize in solution using the dimerization domain. This is similar to the oligomeric association observed in similar proteins:

    Fig2.png

     

    This predicted aminopeptidase PepT has peptidase T specific motif (HXDT) as in structurally similar putative peptidase T (PDB code 1vix). The http://protease.burnham.org/ server predicted it as aspartic protease (it is not an aminopeptidase) with the following active site residues: Asp107 and Asp164.

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     Fig1.png
    No description
    348.45 kB22:01, 3 Feb 2009debanuActions
     Fig2.png
    No description
    370.77 kB22:01, 3 Feb 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch