.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gi7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of secreted protein of unknown function (DUF1311) (NP_742474.1) from Pseudomonas putida KT2440 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3gi7 Target Id 365921
    Molecular Characteristics
    Source Pseudomonas putida kt2440
    Alias Ids TPS6197,NP_742474.1, PF07007 Molecular Weight 13636.88 Da.
    Residues 121 Isoelectric Point 4.21
    Sequence adeeestpcdnvetdqqtfacaafnkqvaerelqsaydeliermrdqfgdeaglmsrieaaekvwsqlr dadckvethaeqpgsnayqiawnsciaqrsderaeylrslgsqnsdepaped
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.199
    Matthews' coefficent 2.64 Rfactor 0.178
    Waters 175 Solvent Content 53.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gi7
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene PP0307 from Pseudomonas putida kt2440 encodes the small secreted protein NP_742474, which folds into a three helix bundle. It is the first structure representative of DUF1311 ( PF07007 family). The domain organization of this protein in related pfam members may provide functional clues to its currently unknown biological function.

    A DALI search with 3gi7 returns only very weak hits (Z-scr=7) with apolipophorin III (1aep) or the metastasis supressor protein 1 (2d1l).

    There are 3 S-S bonds within the 3gi7 tetrameric structure, suggesting a tetramer is likely the physiological relevant state. The cysteines forming S-S bonds are highly conserved. Mapping the sequence conservation to the protein structure (Fig 2-3) indicated that a region near the dimer interface is likely functionally important (Lys85, Trp87, Asp92, Arg124 etc). One pair of conserved cysteines forming S-S (Cys95 & Cys116) are also located at this site.

    According to the LipPred server this is a non-lipoprotein with signal petide cleavage site at position 31.

    Some homologous proteins are annotated as urease-associated.

     

    Figure 1. Tetramer structure of 3gi7

    PC0700E.png

    Figure 2. Mapping sequence conservation on to the protein surface

     PC07007E-surf.png

    Figure 3. Primary sequence alignment

    0-0-1234559120-esp.300.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     0-0-1234559120-esp.300.png
    multiple seq alignment
    103.81 kB21:05, 13 Feb 2009qxuActions
     PC07007E-surf.png
    PC07007E colored by seq cons
    189.17 kB21:13, 13 Feb 2009qxuActions
     PC0700E.png
    PC07007E tetramer
    150.54 kB20:39, 13 Feb 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch