.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gju

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative aminotransferase (NP_107505.1) from Mesorhizobium loti at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3gju Target Id 390987
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS20190,NP_107505.1, 3.40.640.10, 85318 Molecular Weight 49550.71 Da.
    Residues 459 Isoelectric Point 6.07
    Sequence mlnqsnelnawdrdhffhpsthmgthargesptrimaggegvtvwdnngrksidafaglycvnvgygrq kiadaiatqaknlayyhayvghgteasitlakmiidrapkgmsrvyfglsgsdanetnikliwyynnvl grpekkkiisrwrgyhgsgvmtgsltgldlfhnafdlprapvlhteapyyfrrtdrsmseeqfsqhcad kleemilaegpetiaafigepilgtggivpppagywekiqavlkkydvllvadevvtgfgrlgtmfgsd hygikpdlitiakgltsayaplsgvivadrvwqvlvqgsdklgslghgwtysahpicvaagvanlelid emdlvtnagetgayfraelakavgghknvgevrgdgmlaavefvadkddrvffdasqkigpqvatalaa sgvigrampqgdilgfapplcltreqadivvsktadavksvfanl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.168
    Matthews' coefficent 2.18 Rfactor 0.139
    Waters 463 Solvent Content 43.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gju
    1. Crystal structures of the Chromobacterium violaceum__transaminase reveal major structural rearrangements upon binding of coenzyme PLP
    MS Humble, KE Cassimjee, M Hkansson - FEBS , 2012 - Wiley Online Library
     

    Protein Summary

    The gene mll7127 from Mesorhizobium loti encodes the NP_107505 protein, annotated as putative aminotransferase class III (PF00202). Genome context analysis indicstes a possible functional link (score 0.75) with the succinic semialdehyde dehydrogenase mll7128.

    Pre-SCOP classifies 3gju in the alpha/beta class, PLP-dependent transferases superfamily, GABA aminotransferase-like family. 3gju is similar to another PDB:3fcr (Topsan, some other aminotransferases are also discussed here). A DALI search provides strong hits with aminotransferases like 3fcr (Z=66), PDB:3hmu (Z=55), and decarboxylases like PDB:1zod, PDB:1m0q, PDB:1d7r (Z=50).

    3gju is present as a monomer in the crystal structure and there is a PLP molecule (green and pink sticks) bound at the putative active site. Interestingly, like the 3fcr structure, this structure also reveals  that the pyridoxal-5'-phosphate (PLP) adduct is present in 2 forms, as free PLP and as covalently bound to Lys289 as LLP. This may represent some functional or reaction mechanism characteristic of class III aminotransferases. The amino acid immediately preceding this Lys is a Ramachandran plot outlier in both this structure and the 3fcr and this geometry may be related to function.

    Fig1.png

    Ligand Summary

    PLP bound at the putative active site.

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    448.81 kB21:19, 25 Feb 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch