.
The Open Protein Structure Annotation Network
PDB Keyword
.

3grd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-superfamily protein with unknown function (NP_977240.1) from BACILLUS CEREUS ATCC 10987 at 1.25 A resolution. To be published
    Site JCSG
    PDB Id 3grd Target Id 390498
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS14576,NP_977240.1, 3.10.450.50, 88944 Molecular Weight 14968.08 Da.
    Residues 133 Isoelectric Point 5.22
    Sequence mpkanleiirstyegsassnakhlaealsekvewteaegfpyggtyigveaimenvfsrlgsewndyka svnmyhevsgkdviiaegmysgvykdtgksfeaefvhvwqlengkivkfkqyvdshlvreamks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.167
    Matthews' coefficent 2.41 Rfactor 0.133
    Waters 540 Solvent Content 48.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3grd
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Pfam update: On building, this was found to overlap immediately with SnoaL_2, PF12680, WI12 PF07107, and LEH PF07858.

    NP_977240.1 from Bacillus cereus ATCC 10987 encodes an alpha and beta protein that belongs to NTF2-like superfamily (Fig 1). This protein is structurally very similar to JCSG targets, 3ec9 (unchracterized NTF-2-like protein, Z=22.1%, RMSD=1.3A, 39% seqid, Topsan_page ), and 3ebt (ketosteroid isomerase, Z=18.0%, RMSD=1.7A, 24% sedid, Topsan_page). 

     

    dimer_101368.png

     Fig 1. NP_977240.1 contains one biological dimer in asu.

    super_3ec9.png

    Fig 2. Superposition of  NP_977240.1 (green) with 3ec9 (yellow) structures. Two structures are nearly identical.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer_101368.png
    No description
    167.83 kB00:58, 29 Dec 2008gyewonActions
     super_3ec9.png
    No description
    293 kB01:11, 29 Dec 2008gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch