.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gs9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of prophage tail protein gp18 (NP_465809.1) from Listeria monocytogenes EGD-e at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3gs9 Target Id 376562
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS6960,NP_465809.1, PF06605, 104137 Molecular Weight 39471.40 Da.
    Residues 341 Isoelectric Point 5.04
    Sequence mnsdiivadfwknneeiltdfdkdsfceswtenemwsiefkvaqtpknahcysfldyessvyfrgqefv vkqlshdavgktlskdiraphiyytcqdgrqddaitgsftleqclthifktdnrgfsweiidpsnilek vqqenfgnnnyltlidqllddygvvvipdnrhlvfkpreiygaktenfirykyntdeasfdidtlslkt kikgygkvdsngnnyfspitytspevekwgirwqepvsderytvagnmqrrlklelqdypattgsvilk ndyecekgdyvlfiyeplgidydvqivaykkypftikapeitlsnnkksivsimaqlakvlkgak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.223
    Matthews' coefficent 2.59 Rfactor 0.187
    Waters 356 Solvent Content 52.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gs9
    1. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    2. The opening of the SPP1 bacteriophage tail, a prevalent mechanism in Gram-positive-infecting siphophages
    A Goulet, J Lai-Kee-Him, D Veesler, I Auzat - Journal of Biological , 2011 - ASBMB
     
    3. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    4. Phage Pierces the Host Cell Membrane with the Iron-Loaded Spike
    C Browning, MM Shneider, VD Bowman, D Schwarzer - Structure, 2012 - Elsevier
     
    5. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     
    6. Long Noncontractile Tail Machines of Bacteriophages
    AR Davidson, L Cardarelli, LG Pell, DR Radford - Viral Molecular , 2012 - Springer
     

    Protein Summary

    375562 is a protein in a mu-phage tail assembly (Protein gp18 of Bacteriophage A118 from Listeria monocyt
    ogenes EGD-e). The overall structures of both monomer and trimer is similar to 3cdd and 1wru. This protein will be annotated together with 3bjq, the major head protein of a mu prophage.

     

    This protein is part of family DUF1142, PF06605.

     

    Figure 1. Trimeric structure of 375562, a tail protein of phage tail

    PS06605-trimer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     PS06605-trimer.png
    trimer of PS06606
    170.1 kB19:16, 11 Feb 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch