.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h41

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the gamma-D-glutamyl-L-diamino acid endopeptidase YkfC from Bacillus cereus in complex with L-Ala-[gamma]-D-Glu: insights into substrate recognition by NlpC/P60 cysteine peptidases. Acta Crystallogr.,Sect.F 66 1354-1364 2010
    Site JCSG
    PDB Id 3h41 Target Id 396160
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS25850,NP_979181.1, PF00877, 326340 Molecular Weight 34784.53 Da.
    Residues 310 Isoelectric Point 6.17
    Sequence eekkdskafidvsaatlwtapdslrpidvpsatnpvdlwkwtksmtldeklwltnankletqallgqev tvvdkkgdwvkvlvhgqptprneegypgwmpekqltynqefadktnepfvlvtkptailyinpsekhks levsyntrlpllsedtisyrvllpngqkawlrkndgtfyrsqndiptpaaddlintgkmflglpyiwag tsgfgfdcsgfthtiykshgitiprdsgpqsrngvavdkehlqkgdliffahdqgkgsvhhvamyigdg nmihspraersveiiplntpgyieeyagarrylp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.79 Rfree 0.197
    Matthews' coefficent 2.39 Rfactor 0.163
    Waters 270 Solvent Content 48.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3h41
    1. Structure of the-D-glutamyl-L-diamino acid endopeptidase YkfC from Bacillus cereus in complex with L-Ala--D-Glu: insights into substrate recognition by NlpC/P60
    Q Xu, P Abdubek, T Astakhova, HL Axelrod - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Peptidoglycan remodeling in Mycobacterium tuberculosis-comparison of structures and catalytic activities of RipA and RipB
    D Bth, G Schneider, R Schnell - Journal of Molecular Biology, 2011 - Elsevier
     
    3. Ligands in crystal structures that aid in functional characterization
    AE Speers, BF Cravatt - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    4. Structural Analysis of Papain-Like NlpC/P60 Superfamily Enzymes with a Circularly Permuted Topology Reveals Potential Lipid Binding Sites
    Q Xu, ND Rawlings, HJ Chiu, L Jaroszewski, HE Klock - PloS one, 2011 - dx.plos.org
     
    5. Structure of a peptidoglycan amidase effector targeted to Gram-negative bacteria by the type VI secretion system
    S Chou, NK Bui, AB Russell, KW Lexa, TE Gardiner - Cell Reports, 2012 - Elsevier
     
    6. Crystal structure of type VI effector Tse1 from Pseudomonas aeruginosa
    H Zhang, ZQ Gao, XD Su, YH Dong - FEBS letters, 2012 - Elsevier
     
    7. Structural insights into the Pseudomonas aeruginosa type VI virulence effector Tse1 bacteriolysis and self-protection mechanisms
    J Ding, W Wang, H Feng, Y Zhang, DC Wang - Journal of Biological , 2012 - ASBMB
     
    8. Structural insight into functioning of Pseudomonas aeruginosa peptidoglycan-hydolase Tse1 and its immunity protein Tsi1
    S Guijun, L Xiuhua, L Defen, Z Junbing, L Ning - Biochemical , 2012 - biochemj.org
     

    Protein Summary

    Gene Bce_2878 from Bacillus cereus atcc 10987 encodes the NP_979181 protein, a member of Nlpc/P60 family of cysteine peptidases which cleave g-D-Glu-DAP (PF00877).

    The details of the 3h41 structural analysis will be presented later as a follow-up to the 2fg0/2hbw paper later.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch