.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hba

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative phosphosugar isomerase (YP_563707.1) from SHEWANELLA DENITRIFICANS OS-217 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3hba Target Id 391339
    Molecular Characteristics
    Source Shewanella denitrificans os217
    Alias Ids TPS20215,YP_563707.1, 3.40.50.10490, 336164 Molecular Weight 35435.01 Da.
    Residues 333 Isoelectric Point 7.06
    Sequence mttntimeqeartapqkiaeqllandaiteslgsvlrefkpkfvmivgrgssdhagvfakylfeieasi ptfaaapsvasvygktlklagglvivisqsgrspdilaqarmaknagafcvalvndetapikdivdvvi plrageekavaatksylatlsallqvaakwtqneslveavnslpqalqaavdaepqlragsltdvknlv vlgrgfgyavskeialklkevcaihaeafssaeflhgpvtlvekklsildvcirdesygshveqianvk qrganlihlhqtsadihpriaplallqrfyidvaavaialginpdkpaglkkvtqtl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.203
    Matthews' coefficent 2.56 Rfactor 0.165
    Waters 444 Solvent Content 51.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hba
    1. Pharmacophore Design for Anti-inflammatory Agent Targeting Interleukin-2 Inducible Tyrosine Kinase (Itk)
    M Chandrasekaran, S Sakkiah - Bull. Korean , 2010 - newjournal.kcsnet.or.kr
     
    2. Novel l-Cysteine-Dependent Maleylpyruvate Isomerase in the Gentisate Pathway of Paenibacillus sp. Strain NyZ101
    TT Liu, NY Zhou - Journal of Bacteriology, 2012 - Am Soc Microbiol
     

    Protein Summary

    Gene Sden_2705 from Shewanella denitrificans os-217 encodes the YP_563707 protein, annotated as glutamine-fructose-6-phophate transaminase (isomerizing) protein with two SIS (sugar isomerase) domains belonging to the Pfam PF01380. Analysis of its genomic context predicts a functional link (score 0.9) with its neighbor Sden_2704, annotated as N-acetylglucosamine 6-phosphate deacetylase.

    pre-SCOP classifies 3hba in the alpha/beta class, SIS domain superfamily, double SIS domain family. DALI top hits are with putative sugar isomerase PDB:3fj1 (Z=39), glucosamine synthase PDB:1jxa (Z=34), and the glutamine transaminase PDB:2v4m (Z=34). 3hba is present as a dimer in the structure and crystal packing analysis suggests that this dimer is the relevant oligomeric state in solution.

    Fig1.png

    JCSG has solved another crystal structure of a similar SIS domain protein, PDB:3fji (Topsan page for 3fj1). The putative active site residues of 3hba are mostly conserved with that of 3fj1 based on a structural alignment.

    A superposition of 3hba (cyan, citrate molecule in red spheres) with 3fj1 (yellow) and the human glutamine-6-phosphate transaminase (magenta, complexed with fructose-6-phosphate in green spheres, PDB id 2v4m) shows that the citrate is not bound at the putative active site:

    Fig2.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     Fig1.png
    No description
    583.13 kB22:12, 31 Mar 2009debanuActions
     Fig2.png
    No description
    668.16 kB00:09, 28 Jul 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch