.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function (NP_107719.1) from Mesorhizobium loti at 1.96 A resolution. To be published
    Site JCSG
    PDB Id 3hk4 Target Id 390969
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS20864,NP_107719.1, 3.10.450.50, 323944 Molecular Weight 13153.97 Da.
    Residues 117 Isoelectric Point 4.91
    Sequence mtiaeiakdftellkqgdnagaaekynaddiasyeamegpmavshgkealrqksqwwqenhevhggsve gpyvngdqfalrfkfdvtpkatgervtmdevglytvkngkiteerfyy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.96 Rfree 0.220
    Matthews' coefficent 2.24 Rfactor 0.177
    Waters 285 Solvent Content 45.13

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene mlr7391 from MESORHIZOBIUM LOTI encodes the NP_107719.1 protein with 117 residues. 
    The search results from NCBI sequence alignment indicate this hypothetic protein carries a fold belonging to the NTF2_like superfamily protein.  It classifies inside the SnoaL-like polyketide cyclase group (PF07366). It has been suggested as a structural homolog to 1NU3, 1SJW and 1TUH by FFAS and SSM.  There are 4 subunits in each asymmetric unit cell. The interface interaction indicates that the biomolecule of protein NP_107719.1 should be a dimer.

     

    390969_1.png

    Figure 1. Protein NP_107719.1  monomer carries the

    α/β-barrel folding core belonging to the NTF_2 superfamily.

     

    390969_3.png

    Figure 2. The biomolecule of NP_107719.1 (Green) should be a dimer based on interface interaction.


     

     

    390969_2.png

    Figure 3. The biomolecule of NP_107719.1 (Green) should be a structural homolog to  1TUH(cyan), 1SJW (magenta) and 1NU3(yellow).

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch