.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hn7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of the first full-length murein Peptide ligase (mpl) cell wall recycling protein. Plos One 6 e17624-e17624 2011
    Site JCSG
    PDB Id 3hn7 Target Id 391146
    Molecular Characteristics
    Source Psychrobacter arcticus 273-4
    Alias Ids TPS25718,YP_263340.1, 3.40.1190.10, 291233 Molecular Weight 54885.23 Da.
    Residues 505 Isoelectric Point 5.30
    Sequence mhihilgicgtfmgslallaralghtvtgsdaniyppmstqleqagvtieegyliahlqpapdlvvvgn amkrgmdvieymldtglrytsgpqflseqvlqsrhviavagthgktttttmlawilhyagidagfligg vplvnttdtnlqqvfahssylgtekddsdnsvntgyfvieadeydsaffdkrskfvhyrprtailnnle fdhadifadldaiqtqfhhmvrmipstgkiimpaatisledtlakgvwtpiwrtsvidstissvrreds plensqaenssdwqaelisadgsqftvsfndnkeatalvnwsmsglhnvnnalvaiaaaynigvsvkta caalsafagikrrmeligdvndilvfddfahhptaitttldgakkkladrrlwaiieprsntmkmgihq dslaqsatladhtlwyeptglewglkevidnatianpsigsqqvlssvddiikhicthakagdaivims nggfegihqrlltalgnivail
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.187
    Matthews' coefficent 2.13 Rfactor 0.154
    Waters 599 Solvent Content 42.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hn7
    1. Structure and Function of the First Full-Length Murein Peptide Ligase (Mpl) Cell Wall Recycling Protein
    D Das, M Herv, J Feuerhelm, CL Farr, HJ Chiu - PloS one, 2011 - dx.plos.org
     

    Protein Summary

    The Psyc_0032 gene from Psychrobacter arcticum 273-4 codes for the YP_263340 multidomain protein that is annotated as a putative UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase belonging to Pfams PF01225 (Mur_ligase), PF08245 (Mur_ligase middle domain) and PF02875 (Mur_ligase glutamate ligase domain).

    Pre-SCOP classifies 3hn7 as follows: the 1-90 fragment in the MurCD N-terminal domain (super)family; the 98-352 fragment inside the MurD-like peptide ligases, catalytic domain superfamily; and the 354-498 C-terminal fragment in the MurD-like peptide ligases, peptide binding domain superfamily. DALI top hits are with other acetylmurate-Ala ligases like PDB:3eag (Z=38), PDB:1p3d (Z=33), PDB:2f00 (Z=32) and PDB:1j6u (Z=30).

    3hn7 appears as a monomer in the crystal structure (colored from N-term, blue to C-term, red).Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    307.85 kB16:34, 7 May 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch