.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hsa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain. J.Mol.Biol. 396 31-46 2010
    Site JCSG
    PDB Id 3hsa Target Id 381783
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS7331,YP_926556.1, PF08000, 86542 Molecular Weight 13851.40 Da.
    Residues 125 Isoelectric Point 6.28
    Sequence mgfldalmgnasevdlgklaaelspilgdneelqlaykmvrdlfvftskrlilidkqgvtgkkvsyhsi pykaivhfqvetagtfdmdaelklwisgqheplvkelkrgtdvvgiqktiaryalg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.99 Rfree 0.233
    Matthews' coefficent 2.07 Rfactor 0.189
    Waters 242 Solvent Content 40.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hsa
    1. Structural insights into the dynamics and function of the C-terminus of the E. coli RNA chaperone Hfq
    M Beich-Frandsen, B Ve_erek, PV Konarev - Nucleic Acids , 2011 - Oxford Univ Press
     
    2. Structural analysis of full-length Hfq from Escherichia coli
    M Beich-Frandsen, B Vecerek, B Sjoblom - Section F: Structural , 2011 - scripts.iucr.org
     
    3. Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain
    Q Xu, A Bateman, RD Finn, P Abdubek - Journal of molecular , 2010 - Elsevier
     
    4. Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal
    GW Han, C Bakolitsa, MD Miller, A Kumar - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene Sama_0678 from SHEWANELLA AMAZONENSIS SB2B encodes the YP_926556 protein, a member of the bacterial pleckstrin homology domain group (PF08000), which is 80% identical in sequence to 3dcx. It is also related to 3b77.

    SCOP classifies 3hsa inside the all beta class, PH domain-like superfamily, BPHL family. Using 3hsa as query, Dali provides a top hit with a Z-scr of 15 with 3dcx, and a Z-scr=9 with 3b77.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch