.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hzp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function MN2A_0505 from Prochlorococcus marinus (YP_291699.1) from Prochlorococcus sp. NATL2A at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 3hzp Target Id 391203
    Molecular Characteristics
    Source Prochlorococcus marinus str. natl2a
    Alias Ids TPS25733,YP_291699.1, 3.10.450.50, 87417 Molecular Weight 14573.73 Da.
    Residues 130 Isoelectric Point 4.89
    Sequence msskeeilsileafastermgsffldnatadflfirpsgnpldakgfenmwssgdlvlesaeitkvhkf ellgsnaaicvftlgskftykgtqnddlptvtsifkkidekwkvawmqrssgqsdmtlwne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.184
    Matthews' coefficent 2.08 Rfactor 0.167
    Waters 101 Solvent Content 40.84

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam note: I have had to admit to building a DUF for this, as I could find on proper info from anywhere on it. DUF3804 PF12707.

     

    Gene MG14622A encodes the YP_291699.1 protein from Prochlorococcus sp. NATL2A, which is a unicellular cyanobacterium that dominates the temperate and tropical oceans.  The search results from NCBI sequence alignment can not suggest any putative conserved domain. Its sequence belongs to the Ca/calmodulin dependent protein kinase II associaction group (PF08332).

     

    SCOP classifies 3hzp in the alpha+beta class, NTF2-like superfamily, CAMK2A family. Dali search indicates 3hzp carries a NTF2-like fold with a hydrophobic cavity similar to 1JB2, 2R4I, 3FSD and 2UX0.  In this hydrophobic cavity, Arg 118  provides the H-bonding force to hold a  PEG molecule from the crystallization buffer. The interface interaction suggests that the biomolecule of 3hzp is a dimer.

     

     

    391203_2.png

    Figure 1. Structure 3hzp carries an α/β-barrel fold similar to the NTF-2 domain. 

     

    391203_3.png


    Figure 2. The biomolecule of 3hzp should be a dimer based on analysis of its asu.

     

    391203_1.png

    Figure 3.  3HZP (green) is structurally similar to 1JB2, 2R4I, 2UX0 and 3FSD.

     

    391203_4.png

    Figure 4.   Arg 118 in the hydrophobic cavity of  3hzp holds a PEG molecule from the crystallization buffer.
     
     

     

     

     

     

     

     

    References

     

    1.    Chaillan-Huntington, C.,  Butler, P.J.,  Huntington, J.A.,  Akin, D.,  Feldherr, C.,  Stewart, M.   (2001) NTF2 monomer-dimer equilibrium.  J.Mol.Biol.   314: 465-477  

     

     

     

     

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch