The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative metal-dependent phosphohydrolase (YP_926882.1) from Shewanella amazonensis SB2B at 2.06 A resolution. To be published
    Site JCSG
    PDB Id 3i7a Target Id 394288
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS26622,YP_926882.1, _0076.003168_, 326825 Molecular Weight 30899.78 Da.
    Residues 280 Isoelectric Point 5.24
    Sequence msnehqllvgllkklkddalilptlpevamrvqevvgrpdsslkqvaeiigqdaaisariikvansaly srgvpaeninsavtrigltqiksiatsvameqlfistnemvwevmdevwrtsidvtaaacsllqiynkk hpgsglnydtltlaglvhnigalpvlteaeahpemfttiehlrslvrkmqgpigravlkswdfapevme vverwadlpylgdhvsyldfiraaafytgelragneleqrldvfvkrglpvspedlgsdafldsyhsik asye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.06 Rfree 0.236
    Matthews' coefficent 2.70 Rfactor 0.185
    Waters 138 Solvent Content 54.51

    Ligand Information



    Protein Summary

    HD family protein likely involved in signal tranduction in bacteria, also see 3hc1 and 1vqr.


    Figure 1. monomer



    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    mh7544a monomer
    112.89 kB22:16, 19 Jun 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch