.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ib5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Sex pheromone precursor (YP_536235.1) from LACTOBACILLUS SALIVARIUS SUBSP. SALIVARIUS UCC118 at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 3ib5 Target Id 386867
    Molecular Characteristics
    Source Lactobacillus salivarius subsp. salivarius ucc118
    Alias Ids TPS25716,YP_536235.1 Molecular Weight 38405.41 Da.
    Residues 347 Isoelectric Point 6.06
    Sequence essksgyqttgennssdyqgiiedgeyktsksrgvgisqnsdnllnlksfeaglttiskdhfstksyif qegqylnkatiqdwlgrksssnpeglnpsdngkkeankrnpiyvqqieeqdymkqnngklelagmtigi gmnqkdyyqkeqygatysttiskekrieegkiaakkvlarvrqkvgnnvpiviamfaqapndslvggyf ysytvsksgtdigswtetniksyvlpatednklpndndstsfdnfqkevknffpnisnvtgqgqykdkt lqglhitittqfyseteitsftqyvaqaaksylpsgipvdikingsdgetqsfvsttggnggyythvfgsy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.181
    Matthews' coefficent 2.36 Rfactor 0.150
    Waters 544 Solvent Content 47.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    386867 is a predicted lipoprotein. This structure shares significant sequence homology to MCSG structure 2qx2 (29% seq id), which is a sex pheromone staph-cAM373 precursor from Staphylococcus aureus. Packing analysis suggests that this protein is likely to function as a dimer, this is also supported by the fact that dimer surface is conserved.

     

    The exact function of this protein is unknown. The homolog in B. subtilis is likely part of a putative operon encoding pcrB, pcrA, yerG and yerH where pcrA encoding a DNA helicase of the SF1 family, yerG a NAD-dependent ligase.

     

    This protein is now in family CamS (PF07537).

     

    Figure 1. monomeric structure of 386867

    gs13486b.png

    Figure 2. dimer of 386867

     gs13486a.png

    References

    Identification and characterization of genes encoding sex pheromone cAM373 activity in Enterococcus faecalis and Staphylococcus aureus. Flannagan SE, Clewell DB. Mol Microbiol. 2002 May;44(3):803-17  (PMID: 11994160).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     gs13486a.png
    gs13486a dimer
    151.15 kB22:57, 6 May 2009qxuActions
     gs13486b.png
    gs13486a monomer
    83.66 kB22:29, 6 May 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch