.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ieh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative metallopeptidase (YP_001051774.1) from SHEWANELLA BALTICA OS155 at 2.45 A resolution. To be published
    Site JCSG
    PDB Id 3ieh Target Id 375157
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS6832,YP_001051774.1, 3.40.630.10, 292236 Molecular Weight 30306.60 Da.
    Residues 275 Isoelectric Point 5.11
    Sequence mvsrspfesfqwksdifncestdidnfyllleqemtrlgmveknlgevgkykvslyqspaaksglpsll isagfhgeesagpwgllhflseasadlfervnlsllplvnptgfsrghrfnkygenpnrgfvfengkpk anehtsvegkllldhaqlliaacrdgiltchedvlsreayvysfepsqvpgrfsldlrdtlggyfpiav dgeidacpvkdglifnhfdtsfeaclvrsgarvgactetpalqnfdqrvlansaamthflalcaplcd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.45 Rfree 0.222
    Matthews' coefficent 2.72 Rfactor 0.164
    Waters 66 Solvent Content 54.78

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: This protein is now in family PF04952.7 AstE_AspA CL0035.

    Gene Sbal_3428 from Shewanella baltica os155 encodes the YP_001051774 protein, a putative zinc peptidase (CATH family 3.40.630.10 of zinc peptidases). Its sequence belongs to the PF04952.

     

    SCOP classifies 3ieh inside the alpha/beta class, phosphorylase/hydrolase-like fold, Zn-dependent exopeptidase superfamily. It was selected for structure determination along with two other closely related proteins with high sequence identities (~60-70%), whose structures have also been solved, i.e. JCSG targets 375152, PDB id 2qvp; and target 375165, PDB id 3b2y. These two proteins also appear as the top two most significant hits in FFAS.

    A crucial step in obtaining diffraction-quality crystals of this protein was low temperature protein expression and the addition of zinc by co-crystallization. A zinc ion was found bound at the putative active site (His75, Glu78 and His169) and supported by an anomalous difference Fourier map. An unidentified ligand (UNL, red spheres) was also modeled at this site.

     

    Fig1updatedUNL.png

    The 3b2y and 2qvp structures are also the top hits in a search of other proteins of similar structure (Q-score 0.88-0.93). They superimpose on this protein structure with an rmsd ~0.6-0.7A over ~260 Ca residues.

    Further analysis will done at a later date. Please follow the link in the Tags tab below for more information on related crystal structures solved at the JCSG.

    Ligand Summary

    Zinc and UNL at the putative active site.

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     Fig1.png
    No description
    296.91 kB00:12, 12 May 2009debanuActions
     Fig1updatedUNL.png
    No description
    482.19 kB19:21, 19 Jun 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch