.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iic

    Title Crystal structure of CheC-like superfamily protein (YP_001095400.1) from Shewanella SP. PV-4 at 2.13 A resolution. To be published
    Site JCSG
    PDB Id 3iic Target Id 394125
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS26613,YP_001095400.1, _0037.001839_, 326261 Molecular Weight 16742.51 Da.
    Residues 154 Isoelectric Point 4.80
    Sequence mnvdfinpfldsllnvlktmanmelkpgkpnlkkdnlakgdvsgligmvgpqtkgslsitfeetlilei mnkmlgekpesideevtdlvgeltnmvtggaknllsdkgyefdmatpivvsgknhtiahksdgqkiimp fssiygtayieicfeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.13 Rfree 0.256
    Matthews' coefficent 2.22 Rfactor 0.211
    Waters 40 Solvent Content 44.48

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein YP_001095400.1 is annotated as CheC domain protein. YP_001095400.1 (residues 84-120) belongs to PFAM PF04509 which is CheC-like family of proteins. The members of this family, CheC, CheX, CheA and FliY are CheY-P phosphatase. 

     

    The monomer structure is shown below.

    MH11753F.pngMH11753F_cheC.png

          rainbow colored monomer                                                         CheC domain in magenta

     

    The protein likely assembles as a dimer in solution, as shown in crystal packing arrangement below.

    MH11753F_dimer.png

     

    There are several structural homologs of this protein.

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID TITLE
    1 3h2d 26.7 1.4 153 154 77 CHEC-LIKE SUPERFAMILY PROTEIN
    2 3h4y 22.4 1.9 148 154 36 PUTATIVE CHEMOTAXIS PROTEIN
    3 1squ 19.6 2.0 149 152 23 CHEX PROTEIN
    4 1xko 19.4 2.0 150 159 23 CHEMOTAXIS PROTEIN CHEX
    5 2f9z 12.3 3.2 148 190 18 CHEMOTAXIS PROTEIN CHEC
    6 1xkr 12.2 3.4 151 205 17 CHEMOTAXIS PROTEIN CHEC
    7 2hp7 9.9 3.3 142 179 8 FLAGELLAR MOTOR SWITCH PROTEIN FLIM

     

     A superposition of these structures is shown below.

    all.png

    Color scheme: YP_001095400.1 (green), 1squ (cyan), 1xko (lightmagenta), 1xkr (yellow), 2f9z (salmon), 2hp7 (lightgrey), 3h2d (slate), 3h4y (orange).
     

     

    Literature references
    1. Szurmant H, Muff TJ, Ordal GW; , J Biol Chem 2004;279:21787-21792.: Bacillus subtilis CheC and FliY are members of a novel class of CheY-P-hydrolyzing proteins in the chemotactic signal transduction cascade. PUBMED:14749334

    2. Szurmant H, Ordal GW; , Microbiol Mol Biol Rev 2004;68:301-319.: Diversity in chemotaxis mechanisms among the bacteria and archaea. PUBMED:15187186

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch