.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iup

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative NADPH:quinone oxidoreductase (YP_296108.1) from RALSTONIA EUTROPHA JMP134 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3iup Target Id 394240
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS25787,YP_296108.1, _0073.002733_, 326273 Molecular Weight 39883.43 Da.
    Residues 378 Isoelectric Point 6.40
    Sequence mhsalqlrsrikssgelelsldsidtphpgpdevlirieasplnpsdlgllfgaadmstakasgtaerp ivtarvpegamrsmagrldasmpvgnegagvvveagsspaaqalmgktvaaiggamysqyrcipadqcl vlpegatpadgassfvnpltalgmvetmrleghsalvhtaaasnlgqmlnqiclkdgiklvnivrkqeq adllkaqgavhvcnaasptfmqdltealvstgatiafdatgggklggqiltcmeaalnksareysrygs tthkqvylyggldtsptefnrnfgmawgmggwllfpflqkigreranalkqrvvaelkttfashyskei slaevldldmiavynkratgekylinpnkglag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.208
    Matthews' coefficent 2.34 Rfactor 0.175
    Waters 623 Solvent Content 47.36

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Similar in structure to lots of NDPH reductases (e.g. 2vcy).

     

    Fig 1. Dimer of 394240 complexed with NDPH

    mh10766d-dimer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     mh10766d-dimer.png
    MH10766 dimer with NDPH
    124.17 kB17:25, 1 Jul 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch