.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iuw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Activating signal cointegrator (NP_814290.1) from ENTEROCOCCUS FAECALIS V583 at 1.58 A resolution. To be published
    Site JCSG
    PDB Id 3iuw Target Id 392681
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS26567,NP_814290.1, 384337 Molecular Weight 9855.73 Da.
    Residues 82 Isoelectric Point 4.84
    Sequence meqqhptihtlkieteffkavkerrktfeirkndrnfqvgdilileeymngmylddeceaeviyitdya qregyvvlgielh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.58 Rfree 0.222
    Matthews' coefficent 2.73 Rfactor 0.185
    Waters 183 Solvent Content 54.98

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam note: this protein shows distant similarity to the ASCH family (PF04266), but it forms its own family that has now been added to PFAM as DUF3850 (PF12961), a new member of the PUA clan (CL0178). It would be released in PFAM release 25.

     

    Gene NP_814290.1 from ENTEROCOCCUS FAECALIS V583 encodes a protein with 82 residues. The search results from NCBI sequence alignment indicates a conserved domain belonging to ASCH superfamily [Ref].  Dali searching results show that the protein is a structurally similar to the PUA domain, suggesting it may be involved in RNA recognition.   It has been reported that the deletion of PUA genes results in impaired growth (RluD) and competitive disadvantage (TruB) in Escherichia coli.  Suggestions have been put forward that, apart from their usual catalytic role, certain PUS enzymes (e.g. TruB) may also act as chaperones for RNA folding.  The interface interaction indicates that the biomolecule of protein NP_809782.1 should be a dimer.

     

    392681_1.png

    Figure 1. Protein NP_ NP_814290.1 is structurally similar to PUA protein. One cacodylate anion from crystallization is also modeled in the structure. 

     

     

    392681_2.png

    Figure 2. The biomolecule of NP_ NP_814290.1 is a dimer.

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (2)

    FileSizeDateAttached by 
     392681_1.png
    No description
    114.85 kB23:24, 9 Jun 2009kevinjinActions
     392681_2.png
    No description
    169.3 kB23:24, 9 Jun 2009kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch