.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iuz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative glyoxalase superfamily protein (YP_299723.1) from RALSTONIA EUTROPHA JMP134 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3iuz Target Id 381263
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS20130,YP_299723.1, BIG_208, 86813 Molecular Weight 36912.43 Da.
    Residues 339 Isoelectric Point 5.59
    Sequence mhpniatllsanlgesrtrhllslvsvpdglpsdaegratraeiaqalnmvlfagildrvptgraytdd vaatggkvvfdhgalrtvkwrdngalpegeaaftrilrplgyrlngnypldrismtgrsyahadapegi aqffvsefhperfsdafreavgrvtgnsadpltpraqtllwqldrdgvltvadgaeligllvpcferqh gvprladyetllresaemawiategnafnhatdrvddvfglseqqkalgrpmkdkvevsgsgrvkqtaf radtvrrqfigaqgetverdvpgsfyefitrdrfadapaasprvdlgfdagnaqgifkmtaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.206
    Matthews' coefficent 2.90 Rfactor 0.167
    Waters 293 Solvent Content 57.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3iuz
    1. Identification of two-histidines one-carboxylate binding motifs in proteins amenable to facial coordination to metals
    B Amrein, M Schmid, G Collet, P Cuniasse, F Gilardoni - Metallomics, 2012 - xlink.rsc.org
     

    Protein Summary

    Gene Reut_B5534 from Ralstonia eutropha jmp134 encodes the YP_299723.1 protein without a defined Pfam group yet. Based on its co-ocurrence, STRING provides a 0.75 scored hit with the histidine kinase YP_728475.

    Structurally, 3iuz is similar (Dali Z-scr=19) to 2rjb with an 18% of sequence identity and a rmsd of 2.4A for 320 carbon alpha superimposed. 3iuz has less insertions. Of note is that the metal binding site in 2rjb is conserved in 3iuz structure: H81, H237, E303. Other nearby residues are also highly conserved. Thus, it appears that 3iuz and 2rjb have similar function, likely metal hydrolases. However, no metal was detected in 3iuz.

     

    Note from Pfam: This is now in family DUF1338, PF07063, along with 2rjb.

     

    Fig 1. Structural superposition of 3iuz (cyan) with 2rjb (green). The Zn atom of 2rjb is depicted as a red sphere

    pu8575a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     pu8575a.png
    PU8575A vs 2rjb
    374.76 kB17:15, 11 Aug 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch