.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iv0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SusD homolog (NP_809186.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.35 A resolution. To be Published
    Site JCSG
    PDB Id 3iv0 Target Id 396192
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS25871,NP_809186.1, BIG_773, 332854 Molecular Weight 54710.67 Da.
    Residues 480 Isoelectric Point 5.00
    Sequence nksedklsgddfwaqgnetnaeafllsiynsfrnatmsqrpfltysgdmrcapitaystgdkyvaylan ndmgelrntypddargglimqwdvfytaiqdanillaeidkvpgmdelkrsrfkaeaifmrslsyffiv rafgdvpyytnayneaplprtnmvivlqncladlqplldddpgaevlpwsyssysskgirasrgsvial mmhinlwlvqfdaqnkeqyyrnvvslgeelernngayslldinrssvifaggsdeglfeiaqninfnei fmmnakfsdnvsysclnksmplfcysgdylmtlfpmyeddarkelwfdekiystsvsssapkeikkfwn idtygngtitsnsgnqivfryagalllyaealaalgtndtkacellnrvrnrahaseintsgselmdai fwercreligeghyyydlvrtgkvynrnycmnpmtrtnfnvgawtwpihrnalknntqiglnlfwe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.167
    Matthews' coefficent 2.12 Rfactor 0.146
    Waters 610 Solvent Content 41.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3iv0
    1. Glycan recognition by the Bacteroidetes Sus-like systems
    DN Bolam, NM Koropatkin - Current Opinion in Structural Biology, 2012 - Elsevier
     

    Protein Summary

     

    Pfam:  this target belongs to PF07980.

     

    PX15618A/NP_809186.1 encodes a protein with 503 residues from Bacteriodes thetaiotaomicron vpi-5482.  It has been suggested as SusD homolog based sequence alignment. The NCBI sequence alignment indicates that residue 360 to 503 is the putative conserved domain belonging to the SusD superfamily.  This target is a structural homolog to B. thetaiotaomicron SusD protein (PDB ID: 3CK7).  

     

    396192_1.png

    Figure 1. Protein NP_809186.1 contains a putative conserved domain belonging to the SusD superfamily.

     

     

    396192_2.png

    Figure 2. The directly superposing comparsion between protein NP_809186.1(green)

    and B. thetaiotaomicron SusD protein (PDB ID: 3CK7)

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     396192_1.png
    No description
    216.38 kB21:24, 19 May 2009kevinjinActions
     396192_2.png
    No description
    184.81 kB21:24, 19 May 2009kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch