.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SusD superfamily protein (YP_001297730.1) from Bacteroides vulgatus ATCC 8482 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3jq1 Target Id 396548
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS26680,YP_001297730.1, BIG_773, 332852 Molecular Weight 55733.32 Da.
    Residues 480 Isoelectric Point 4.96
    Sequence tedtfwkdetdfnlaltscytplknalnggyygtrgvmlriaradevdfrndisdvytvnrftnsntns ltqgmfyqfynalyrtnsimqkleekkeqfstdfqnsvkgeclfirgfylfqlakefkdaplrltasqs pstfplakssqadiwaqakedlktaasllpitnkigkptqgaayaalgkiyvyeenwqeainvlepltq npytyklvedfnwnfddthennaesifelliedvggtdlwgdgeninstqsntrpkeyaaaevggwyea nptqqimdifwkekdkdgnfdyrarcsvawdyegctyyqrpfrevfaqdkwktywilkyqnwktqkdep appksfinerairyadvllmlaeaymnkgaldtsigyinqirrranlndysgpitkegvfedlvhqrai effvegerfydlrrwglleqtlktcddtryknyqtgksdninkfnyfpipakeldtnplctpsegw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.209
    Matthews' coefficent 2.28 Rfactor 0.172
    Waters 1486 Solvent Content 46.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    A member of SusD family, similar to 3ckc (rmsd 2.0A for 307 aligned Ca, 19% id).

     

    Figure 1. monomer of 396548.

    px14375d.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     px14375d.png
    px14375d
    245.29 kB20:06, 13 Jul 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch