.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jsj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative transcriptional regulator (NP_821317.1) from Streptomyces avermitilis MA-4680 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3jsj Target Id 379891
    Molecular Characteristics
    Source Streptomyces avermitilis ma-4680
    Alias Ids TPS24221,NP_821317.1, _0052.002647_, 87129 Molecular Weight 20397.05 Da.
    Residues 189 Isoelectric Point 5.50
    Sequence mttevkqsprerlleaaaaltyrdgvgigvealckaagvskrsmyqlfeskdellaaslkersaafvak alppaddgrsprerilyvfervesqagapdfqgcrylavqielkdqahpasrvayqikadlmaffrsea erggasdpdllarqlilvfdgasaragigadnltglivptlttlldaadmh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.230
    Matthews' coefficent 2.91 Rfactor 0.189
    Waters 452 Solvent Content 57.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3jsj
    1. Ab Initio Modeling Led Annotation Suggests Nucleic Acid Binding Function for Many DUFs
    DJ Rigden - Omics: a journal of integrative biology, 2011 - online.liebertpub.com
     

    Protein Summary

    Gene SAV143 from Streptomyces avermitilis ma-4680 encodes the NP_821317 protein, annotated as a putative TetR-transcriptional regulator. This bacterium is of industrial importance since it produces a polyketide-based drug used for treating parasitic worm infestations in humans and livestock (see Pubmed ID 10449723).

    NP_821317 belongs to the TetR_N (PF00440) Pfam A group. The TetR_N Pfam A group is represented by 82 structures in the PDB, and the structure described here (3jsj) is very similar to previously reported structures like 3g7r (Dali Z=21), 3dpj (Z=18), 3knw (Z=16).

    Analysis of the structure using the fastSCOP evolutionary classification server indicates 3jsj is composed of two domains. The first domain (residues 1-75) is similar to DNA/RNA binding proteins in the homeodomain-like SCOP superfamily. The larger domain (residues 76-183) is similar to the tetracyclin repressor-like C-terminal domain SCOP superfamily.

    3jsj structure was determined by Se-SAD to a resolution of 2.10 Angstroms.monomer.png

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

    Shown above is a ribbons representation of the structure of the monomer of 3jsj. The crystal structure suggests that a dimer is a significant oligomeric state.

    dimer.png

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

    Shown above is a ribbons representation of the structure of the dimer of 3jsj with the individual subunits colored blue and yellow. 

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer.png
    No description
    208.53 kB22:10, 9 Aug 2009haxelrodActions
     monomer.png
    monomer ribbons representation
    146.28 kB21:34, 9 Aug 2009haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch