The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
        1. 1.1.1. Protein Summary
    1. 2. DALI Summary
        1. 2.1.1. Ligand Summary

    Title Crystal structure of Putative phosphoheptose isomerase (YP_001815198.1) from EXIGUOBACTERIUM SP. 255-15 at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 3jx9 Target Id 392463
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS26559,YP_001815198.1, 325578 Molecular Weight 18981.79 Da.
    Residues 169 Isoelectric Point 5.10
    Sequence mlkilatqfngklqtltkqedelfdvvrllaqalvgqgkvyldaygefeglypmlsdgpdqmkrvtkik dhktlhavdrvliftpdtersdllaslarydawhtpysiitlgdvtetlersiaplalkfdkgllpaed gsrhglpslalgafllthiltqlqemteewe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.188
    Matthews' coefficent 2.94 Rfactor 0.163
    Waters 312 Solvent Content 58.18

    Ligand Information



    Protein Summary

    Pfam update:This sequence is now obsolete. I dont understand this comment - this protein shows up both in NCBI (http://www.ncbi.nlm.nih.gov/protein/YP_001815198.1) and UniProt (http://www.uniprot.org/uniprot/B1YEL3). In the other hand, its is not included in NCBI NR database.

    Gene Exig_2733 from Exiguobacterium sp. 255-15 encodes the YP_001815198.1 protein with 169 residues belonging to Pfam DUF2529 family ( PF10740). It is present as a dimer in the crystal structure and crystal packing analysis suggests that this dimer should be the stable oligomeric form in solution.


    DALI suggests that the structure is similar to phosphoheptose isomerase. The superposition of 3jx9 (light green) with (putative) phosphoheptose isomerases - 3cvj (light blue) and 3bjz (light pink) - are shown below.

    The biological unit of 3jx9 and 1cvj is a dimer; in contrast, the biological unit of 3bjz is a tetramer.

    DALI Summary

        No:  Chain   Z    rmsd lali nres  %id PDB  Description

    Ligand Summary





    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch