.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Octomeric Two-Subunit TrkA K+ Channel Ring Gating Assembly, TM1088A:TM1088B, from Thermotoga maritima. To be Published
    Site JCSG
    PDB Id 3jxo Target Id 406264
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS30798,TM1088B Molecular Weight 8495.36 Da.
    Residues 79 Isoelectric Point 4.59
    Sequence ipleqgieflsvnveedspvvgkklkdlplprdsiiaaivrggvlvvprgdteilsgdklyvivsaeak etveetllgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.18741
    Matthews' coefficent 2.59 Rfactor 0.15780
    Waters 89 Solvent Content 52.53

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM1088 gene from Thermotoga maritima encodes the NP_228894 protein containing in its C-terminal part (148-216) a potassium uptake (TrkA-C) domain (PF02080, COG0569). Genome context analysis indicates a likely (score 0.98) functional linkage of TM1088 with the TRK system potassium uptake protein TrkH (TM1089).

    3jxo adopts a new fold termed TrkA C-terminal domain-like. 3jxo shows significant structural similarity to other TrkA C-terminal domains  like 1VCT (Z=9.6), 1lnq (Z=9.8), and 2bko (Z=9.9).

    For more information on the structure and function of this family, see related publications [Ref][Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch