.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jzl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative cystathionine beta-lyase involved in aluminum resistance (YP_013912.1) from Listeria monocytogenes 4b F2365 at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 3jzl Target Id 390911
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS20168,YP_013912.1, 3.40.640.10, 85309 Molecular Weight 44876.83 Da.
    Residues 408 Isoelectric Point 5.18
    Sequence mnniqairkkvetqiddlqnktdeiaefnqakvldafqenkvsdfhfhpstgygyddegrdtlervyat vfkteaalvrpqiisgthaistvlfgilrpddellyitgqpydtleeivgirkqgqgslkdfhigyssv pllengdvdfpriakkmtpktkmigiqrsrgyadrpsftiekikemivfvkninpevivfvdncygefv eyqeppevgadiiagsliknpggglaktggyiagkealvdlcgyrlttpgigreagaslysllemyqgf flaphvtaqaikgarftaamlaefgveadpvwdaprtdliqsvsfhnkekmvafaqaiqaaspvnahvl pigaympgyeddvimaagtfiqgasleltadgpirepyqlyvqggltyehikiavtraiqkiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.241
    Matthews' coefficent 2.10 Rfactor 0.210
    Waters 274 Solvent Content 41.43

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Target ID 390911 belongs to the Alum_res (PF06838) Pfam A group, and proteins belonging to this Pfam group have been implicated in aluminium resistance in some bacteria ( PUBMED:9367855). The structures of orthologs of this protein have been determined by JCSG including PDB ID 3i16, 3hvy, 3gwp, and 3fd0. The structure of target ID was determined at a resolution of 1.91 Angstrom, and phased using Se-SAD. Shown below is a ribbons representation of a monomer of target ID 390911 with the residues color coded with N-terminal residues in blue and C-terminal residues in red. The structure described here is quite similar to the orthologs listed above.

    monomer.png

    Pyridoxal-5'-phosphate (PLP) was added to the crystallization solutions at a concentration of 1 mM. Electron density maps show that PLP (shown in magenta above)  is covalently bound to the protein through a Schiff base interaction with the NZ sidechain atom of Lys 226. Crystal packing indicates that a tetramer is the predominant oligomerization state in solution. Shown below is a ribbons representation of the tetramer.

     

    tetramer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     monomer.png
    No description
    654.91 kB19:52, 14 Jul 2009haxelrodActions
     tetramer.png
    No description
    916.33 kB20:01, 14 Jul 2009haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch