.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k2k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative carboxypeptidase (YP_103406.1) from BURKHOLDERIA MALLEI ATCC 23344 at 2.49 A resolution. To be published
    Site JCSG
    PDB Id 3k2k Target Id 375074
    Molecular Characteristics
    Source Burkholderia mallei atcc 23344
    Alias Ids TPS25172,YP_103406.1, 3.40.630.10, 93033 Molecular Weight 43135.06 Da.
    Residues 384 Isoelectric Point 5.16
    Sequence mtlsitsnfdagaidvvsceradairlrvrgdnrsefaqwfyfrltgargercvmtfenandcaypagw rdyravasydrvnwfrvptsydgqmltidhtpefdsihyayfepyseerhseflgavqqmpqasvvelg rtvegrpmslvvlgtpdeagaakkkvwiiarqhpgesmaewfieglvkrlvgwgdwsgdpvarklydha tfyivpnmnpdgsvhgnlrtnaaganlnrewmepdaerspevlvvrdaihaigcdlffdihgdedlpyv faagsemlpgfteqqrveqsafidsfkraspdfqdehgyppgkyredafklaskyighrfgclsltlem pfkdnanlpdehigwngarsaslgaamlgailehvrafa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.49 Rfree 0.185
    Matthews' coefficent Rfactor 0.156
    Waters 160 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k2k
    1. The novel structure of a cytosolic M14 metallocarboxypeptidase (CCP) from Pseudomonas aeruginosa: a model for mammalian CCPs
    A Otero, MR de la Vega, S Tanco, J Lorenzo, FX Avils - The FASEB Journal, 2012 - FASEB
     
    2. A missense mutation in AGTPBP1 was identified in sheep with a lower motor neuron disease
    X Zhao, SK Onteru, KE Dittmer, K Parton, HT Blair - Heredity, 2012 - nature.com
     

    Protein Summary

    Pfam update: This sequence matches Peptidase_M14 (PF00246).

    This is a putative zinc peptidase.

    The putative active site is at His171, His268 and Glu174 (red sticks). Other residues Glu344, Glu271 and Asp270 (cyan) and water molecules (orange and blue spheres) near this site may also be involved in function.

    Fig1.png

    Please follow the Zinc_Peptidase group tag via the Tag page link below for more information on this and related protein structures solved at the JCSG.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    427.64 kB20:52, 20 May 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch