.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k6o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function DUF1344 (YP_001299214.1) from Bacteroides vulgatus ATCC 8482 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3k6o Target Id 393241
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS25276,YP_001299214.1, 332471 Molecular Weight 25131.12 Da.
    Residues 223 Isoelectric Point 4.52
    Sequence sscgndesdpdstvtiamatvekqpqydapylvldngeklwvvqhivpyrdlkagerifgnysfleage sgfaynirlndytlvpvqkiiglnpdnmdsignmkvqikdmwpsddylnvrfmlnfpspqkpilnlvvn emipwtkdgyahlelrynnngsqgrlvpgmvsfklddyspenselkgikvlvnpvdgeektyifsyplt gedvpgfnpldlaelk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.207
    Matthews' coefficent 3.15 Rfactor 0.175
    Waters 307 Solvent Content 60.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k6o
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The protein YP_001299214.1 is annotated as hypothetical protein BVU_1918. There is no PFAM assignment of this protein.

    ---------------------------------------------------------------------------------------------------------------

    Note from PFAM:

    This sequence falls into the family built from target Q5LAY5_BACFN, ie NigD PF12667.

    ---------------------------------------------------------------------------------------------------------------

     

    The monomer structure, shown below, consists of two domains: an N-terminal beta-barrell domain and a C-terminal beta-sandwich domain.

    0GS13708A.png

     

     

    There are few structural homologs of this protein, as shown by a DALI search.

    N PDB Z-score RMSD LALI NRES %ID TITLE
    1 1qil 6.3 7.9 78 194 9 TOXIC SHOCK SYNDROME TOXIN-1
    2 2qil 6.2 7.9 78 194 9 TOXIC SHOCK SYNDROME TOXIN-1
    3 1ts4 6.2 8.8 78 194 10 TOXIC SHOCK SYNDROME TOXIN-1
    4 1aw7 6.2 7.9 79 194 10 TOXIC SHOCK SYNDROME TOXIN-1
    5 5tss 6.1 8.5 79 194 8 TOXIC SHOCK SYNDROME TOXIN-1
    6 1ts2 6.1 9.0 78 194 10 TOXIC SHOCK SYNDROME TOXIN-1
    7 2ij0 5.9 9.0 80 191 10 TOXIC SHOCK SYNDROME TOXIN-1
    8 4tss 5.8 8.4 79 194 8 TOXIC SHOCK SYNDROME TOXIN-1
    9 3fhw 5.7 3.0 67 100 12 PRIMOSOMAL REPLICATION PROTEIN N
    10 2tss 5.7 9.0 78 194 10 TOXIC SHOCK SYNDROME TOXIN-1

    Most of these proteins have similarities limited to the first domain, as shown by the superposition of the protein (green) on 1qil (magenta).

    GS13708A_1qil.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch