.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k9i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative protein binding protein (NP_241345.1) from Bacillus halodurans at 2.71 A resolution. To be published
    Site JCSG
    PDB Id 3k9i Target Id 361720
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS6119,10173092 Molecular Weight 13015.18 Da.
    Residues 116 Isoelectric Point 5.13
    Sequence vlgleaqavpyyekaiasglqgkdlaecylglgstfrtlgeyrkaeavlangvkqfpnhqalrvfyamv lynlgryeqgvelllkiiaetsddetiqsykqailfyadkldetwka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.71 Rfree 0.233
    Matthews' coefficent 3.45 Rfactor 0.221
    Waters Solvent Content 64.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k9i
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    BH0479 of Bacillus halodurans is a hypothetical protein which contains  a tetratrico peptide repeat (TPR) structural motif. TPR motif is often involved in mediating protein-protein interaction. This protein is likely to function as a dimer. The first 48 amino acids are not present in the clone construct.

     

    A member of TPR_5 of TPR_5 (PF12688) in PFAM, part of the TPR clan CL0020.

     

    Dimer of 10173092

    CL5873A.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     CL5873A.png
    CL5873A dimer
    107.12 kB21:58, 3 Sep 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch