.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kgy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative dihydrofolate reductase (YP_001636057.1) from CHLOROFLEXUS AURANTIACUS J-10-FL at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3kgy Target Id 394390
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS27855,YP_001636057.1, _0052.000516_, 326853 Molecular Weight 23836.07 Da.
    Residues 212 Isoelectric Point 6.66
    Sequence mskvfvnislsldgfmapegmdmahfsdptyknwgakwgalmawalsqqylreklklgtggetgpvndm vrhtfertgahimgkrmfeggergwpeeapfhtpvyvltherrnpwvrpggttfyfvndgpeqalalar eaagerdirisgganviqqylnlglvdeleialipvifgggrrlfenlheplpqfridrvlasptathl ryvrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.174
    Matthews' coefficent 2.10 Rfactor 0.149
    Waters 566 Solvent Content 41.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kgy
    1. Quantifying instrument errors in macromolecular X-ray data sets
    K Diederichs - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
     
    2. Structural-based analysis of dihydrofolate reductase evolution
    D Hecht, J Tran, GB Fogel - Molecular Phylogenetics and Evolution, 2011 - Elsevier
     

    Protein Summary

    Pfam: this protein is now in family PF01872,  containing 10 RibD_C CL0387 along with other structures.

     

     

    Target ID 394390 belongs to the RibD C-terminal domain (PF01872) Pfam A family. The structural basis for this Pfam class has been investigated, with 8 structures deposited for the family in the PDB.  Shown below is a ribbon representation of the structure color-coded with the N-terminus in blue and the C-terminus in red. The structure was determined to a resolution of 1.50 Angstroms using three wavelength Se-multiwavelength anomalous dispersion. The structure of target ID 394390 is similar to those belonging to the Dihydrofolate reductase. 

     

    394390_1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     394390_1.png
    No description
    754.25 kB22:57, 30 Sep 2009kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch