.
The Open Protein Structure Annotation Network
PDB Keyword
.

3khi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor. J.Bacteriol. 194 2987-2999 2012
    Site JCSG
    PDB Id 3khi Target Id 388889
    Related PDB Ids 3dl1 
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS7568,YP_001336084.1, PF06167, 104687 Molecular Weight 30302.69 Da.
    Residues 266 Isoelectric Point 4.77
    Sequence mmfkwpwkaddesgnaempweqalaipvlahlssteqhkltqmaarflqqkrlvalqgleltplhqari amlfclpvlelgiewldgfhevliypapfivddeweddiglvhnqrvvqsgqswqqgpvvlnwldiqds fdasgfnlvvhevahkldtrngdrasgvpliplrevagwehdlhaamnniqdeidlvgesaasidayaa tdpaecfavlseyffsapelfaprfpalwqrfchfyrqdplarrrenglqdegdrrivh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.213
    Matthews' coefficent 2.60 Rfactor 0.183
    Waters 124 Solvent Content 52.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3khi
    1. The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor
    Q Xu, AK Ghler, A Kosfeld, D Carlton - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary

    YP_001336084.1 from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 has sequence similarity to PF06167 (DUF980) (E-value: 2.6e-129), which overlaps with COG3228: Uncharacterized protein conserved in bacteria [Function unknown][1] (E-value: 4e-96). It is highly similar to MtfA (PeeI, YeeI) of E. coli (sequence idenitity of 76%) which is involved in the regulation of phosphoenolpyruvate:glucose phosphotransferase (ptsG) expression by binding and inactivating the repressor Mlc (MtfA interacts with Mlc with high affinity). As a result, this protein is an MtfA homolog.

     

    According to Dali, it is structually similar to anthrax lethal factor (ALF) with Z-scores above 8.0 for PDB codes 1j7n and 1yqy: domain 1 (27:263) (rmsd 3.3 for 137 aligned Ca, 10% seq id); domain 3 (550:773) (rmsd 3.3 for 118 aligned Ca, 13% seq id). HHpred and FATCAT top hit is with 1j7n (P-val=9.4e-7; 2.6e-5, respectively). Interestingly, YP_001336084.1 also contains a Zn metal binding site like domain 4 of anthrax, consisting residue His112, His149, His153, Glu212 (nearby Glu150, Glu219 not conserved in ALF). However, there is no metal observed in the structure (Zn?). YP_001336084.1 model does not contain the loop 98-124 which is likely involved in recruiting and binding substrates (probably only ordered in substrate bound form?). We propose that YP_001336084.1 is a metal dependent hydrolase.

     

    Fig 1: YP_001336084.1 has a fold that is similar to the catalytic domain of ALF

    Fig1a_L.png

    Ligand Summary

     

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1a_L.png
    pk5307b
    979.6 kB20:07, 26 Oct 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch