.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kiz

    Title Crystal structure of Putative phosphoribosylformylglycinamidine cyclo-ligase (YP_676759.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3kiz Target Id 394475
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS25804,YP_676759.1, _0066.001854_, 325446 Molecular Weight 42938.62 Da.
    Residues 393 Isoelectric Point 5.53
    Sequence msssdrymqrgvssqkedvhkaiksidkgiyprafckiipdilggdpeycnimhadgagtksslayvyw ketgdisvwkgiaqdavimniddlicvgavdnillsstigrnknlipgevlaaiingteevlqmlrdng igiystggetadvgdlvrtiivdstvtcrmkrqdvisnenikagnvivgfasygqtsyeteynggmgsn gltsarhdvfnnvlaskypesfdpkvpenlvysgemnltdpylnvpldagklvlsptrtyaplmkeiih qykgkldgvvhcsgggqtkvlhftdatthiikdnlfdvpplfqliqgqsntpweemykvfnmghrleiy tdaahaegmiaiakkfnieakiigrveapvagkrltitgpqgteytya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.187
    Matthews' coefficent 2.06 Rfactor 0.159
    Waters 936 Solvent Content 40.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein SummaryThis protein is annotated as a phosphoribosylformylglycinamidine cyclo-ligase.

    This protein is annotated as a phosphoribosylformylglycinamidine cyclo-ligase.

    It does not have a Pfam assignment yet.

    The top hits in FFAS are to to proteins with PDB ids 1cli (the E. coli PurM protein that is involved in purine biosynthesis, score -65.7), 2z01 (-63.1), 2v9y (-60.1) and 2btu (-58.9).

    It is present as a dimer in the crystal structure:

    Fig1.png

    Ligand Summary

    Pfam update: On building, this protein immediately overlapped with AIRS PF00586, as indicated in the TOPSAN information on the target. There are many structures for this family.

    This Pfam update has been inserted in the ligand summary section because the protein summary section appears that it cannot be updated.

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    461.53 kB23:56, 12 May 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch