.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kny

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein BT_3535 (NP_812447.1) fromBACTERIODES THETAIOTAOMICRON VPI-5482 at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 3kny Target Id 393001
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS20283,NP_812447.1, 325025 Molecular Weight 24419.84 Da.
    Residues 217 Isoelectric Point 4.96
    Sequence aceqnedwvvnepmqsfeenpeyaplntipdwvsekvtpkeyelwrtmssryeinysflkkdisekrkk eiydcinniceriekgqinkyegflniadedgttlsdsqyfgriatrspeggaeyktngctlythslgp yikaavtykksdddvtitsssvytgspylgndpsfsgassvsydkdkkliaascsgtlsfkdgsrkvev tvqktgfmip
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.239
    Matthews' coefficent 4.00 Rfactor 0.202
    Waters Solvent Content 69.23

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene BT_3535 from Bacteriodes thetaiotaomicron encodes the secreted lipoprotein NP_812447 which appears to be specific to this organism, since its only homolog is its genomic neighbour BT_3534 (NP_812446). Three additional homologs were identified in the unnamed Bacteroid species sequenced at the Broad Institute and one in metagenomics samples.

    The solved structure of BT_3535 (3kny) shows a two domain protein, with a novel variant of a meander beta barrel at the C-terminus and a three helical bundle at the N-terminus. SSM matches the C-terminal beta region to human adaptin 2dwy (43% SSE), involved in clathrin mediated vesicle trafficking. For the same region, Dali finds weak structural similarity (z-score 3.8) with the human gamma1-adaptin ear domain (1iu1). 3kny structure shows that the conserved residues are clustered together on the protein surface, indicating the functional importance of the 3 helices bundle region, fragment 30 to 110, near the residues K53/K77.

     

    Fig 1. Structure of 3kny

    gs13556a.png

    Fig 2. BT_3535 amino acid sequence homologs

    gs13556a-homologs.png

    Fig 3. 3kny conserved residues are clustered together on the surface, suggesting their functional importance

    gs13556a-conv.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
     gs13556a-conv.png
    gs13556a conservation
    124.36 kB23:02, 22 Oct 2009qxuActions
     gs13556a-homologs.png
    gs13556 homologs
    51.67 kB22:54, 22 Oct 2009qxuActions
     gs13556a.png
    gs13556a monomer
    108.34 kB22:26, 22 Oct 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch