.
The Open Protein Structure Annotation Network
PDB Keyword
.

3knz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative sugar binding protein (NP_459565.1) from Salmonella typhimurium LT2 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 3knz Target Id 391509
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS20901,NP_459565.1, 3.40.50.10490, 325206 Molecular Weight 38194.89 Da.
    Residues 347 Isoelectric Point 5.92
    Sequence mnetplrllemltqtredlwraaqaltergvtriiltgsgtsyhgaltartfmqrwcalpvdvcwpfml ddetlarsgkalvvgisqgggslstlaamerarnvghitasmagvapatidraadyiltvpcgeetaga ktkgyhctvlnlmllalavagqqqrldgeqrrslllrmektfnhlpalvtasqawaqtnalalrdsadi rltgpatlfgtvqegalkmletlrcpvsgyefeefihgiynafnaqsalimldpqpdarqdrlaqilge wtpsiyrigpqvennglnlnfpfvndedfavfeyiiplqmlcailppqkginpaipkdpqfhqkmkskqei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.232
    Matthews' coefficent 3.30 Rfactor 0.203
    Waters 431 Solvent Content 62.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3knz
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

     This protein is annotated as a putative inner membrane protein in Pfam PF01380, SIS (Sugar Isomerase) domain family.

     There are 6 protomers in the asymmetric unit of the unit cell in the crystal structure (forming 3 dimers), but crystal packing analysis and size-exclusion chromatography coupled with static light scattering support the assignment of the dimer as the significant oligomeric state in solution:

    Fig1.png

    Numerous other SIS domain protein structures have been solved at the JCSG with similar structure and highly significant FFAS scores. Their PDB ids are 3g68, 2aml, 3fj1, 3hba, 1j5x, 3eua, 3fkj and 2a3n. Very nice summary and comparisons of these structures is present in the TOPSAN pages for 3g68.pdb , 3fj1.pdb , 3hba.pdb, 3eua.pdb, and 3fkj.pdb,

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    507.22 kB21:12, 12 Nov 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch