.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ktc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative sugar isomerase (YP_050048.1) from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043 at 1.54 A resolution. To be published
    Site JCSG
    PDB Id 3ktc Target Id 394440
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS26631,YP_050048.1, _0033.000617_, 325454 Molecular Weight 37121.02 Da.
    Residues 332 Isoelectric Point 4.84
    Sequence matynypefgaglwhfanyidryavdgygpalstidqinaakevgelsyvdlpypftpgvtlsevkdal kdaglkaigitpeiylqkwsrgaftnpdpaaraaafelmhesagivrelganyvkvwpgqdgwdypfqv shknlwklavdgmrdlaganpdvkfaieykpreprvkmtwdsaartllgiedigldnvgvlldfghaly ggespadsaqliidrgrlfgmdvndnlrgwdddlvvgtvhmteifeffyvlkinnwqgvwqldqfpfre nhveaaqlsirflkhiyraldkldipalqaaqeaqnplqaqrivqdallssitvse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.54 Rfree 0.157
    Matthews' coefficent 2.37 Rfactor 0.136
    Waters 712 Solvent Content 48.19

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    MH15451A/YP_050048.1 encodes a protein with 333 residues from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043.  The search results from NCBI sequence alignment indicates this target be a xylose isomerase.  The SSM structural comparison also shows that this protein is a structural to xylose isomerase (PDB ID:  1BXB and 1BXC).  Metal ions in multi-metal binding sites are modeled in the conserved active site consisting of Glu166, Asp201, His204, Asp229, Asp238, Asp 270.  Ethylene glycol molecules from cryoprotectant are also modeled in the active site. These ethylene glycols molecules are assembled as a structural homolog to the open-form xylose.   The interface interaction suggests that the biomolecule of YP_050331.1 be a tretramer.

     

    394440_1.png

    Figure 1. Protein YP_050048.1 carries a (β/α)8 –barrel.

     

    394440_4.png

    Figure 2. The biomolecule of YP_050048.1 should be a tetramer based on interface interaction.

     

     

    394440_2.png

     

    Figure 3.Protein YP_050331.1 (green) is structural homolog to xylose isomerase (PDB ID: 1BXB).

     

     

    394440_3.png

     

    Figure 4.  Metal ions are modeled in the conserved active site consisting of Glu166, Asp201, His204, Asp229, Asp238, Asp 270. 

     

     

     

     

     

    References,

    1. 1.    Chang, C.,  Park, B.C.,  Lee, D.S.,  Suh, S.W.  (1999) Crystal structures of thermostable xylose isomerases from Thermus caldophilus and Thermus thermophilus: possible structural determinants of thermostability.  J.Mol.Biol.   288: 623-634  

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch