.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ktd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Prephenate dehydrogenase (NP_599479.1) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 3ktd Target Id 374698
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS6782,NP_599479.1, PF02153, 432875 Molecular Weight 36287.96 Da.
    Residues 340 Isoelectric Point 6.17
    Sequence mttkdisrpvcilglgliggsllrdlhaanhsvfgynrsrsgaksavdegfdvsadleatlqraaaeda livlavpmtaidslldavhthapnngftdvvsvktavydavkarnmqhryvgshpmagtansgwsasmd glfkravwvvtfdqlfdgtdinstwisiwkdvvqmalavgaevvpsrvgphdaaaarvshlthilaetl aivgdnggalslslaagsyrdstrvagtdpglvramcesnagplvkaldealailhearegltaeqpni eqladngyrsriryearsgqrrakesvsptitssrpvlrlhpgtpnwekqlihaetlgarievf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.254
    Matthews' coefficent 2.66 Rfactor 0.213
    Waters 92 Solvent Content 53.82

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: This is a member of PDH (PF02153) family.

    Gene Cgl0226 from Corynebacterium glutamicum atcc 13032 kitasato encodes the NP_599479 protein annotated as a prephenate dehydrogenase (Pfam PF02153). These proteins are involved in tyrosine biosynthesis.

    There are 4 protomers in the asymmetric unit of the crystal structure but crystal packing analysis supports the assignment of the following tight dimer as the signficant oligomeric form in solution:

    Fig1.png

    The top hits in FFAS&DALI searches are with other prephenate dehydrogenases (PDB ids 3dzb, Zscr=25; 3ggg, Zscr=27; and with 2f1k, Zscr=28) and to the prephenate dehydrogenase domain of a T-protein (prephenate dehydrogenase+chorismate mutase) solved at the JCSG (PDB id 2pv7, Zscr=18).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    476.95 kB17:45, 11 Nov 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch