.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kw0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Papain-Like NlpC/P60 Superfamily Enzymes with a Circularly Permuted Topology Reveals Potential Lipid Binding Sites. Plos One 6 e22013-e22013 2011
    Site JCSG
    PDB Id 3kw0 Target Id 377928
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS7018,NP_982244.1, 92744 Molecular Weight 22236.13 Da.
    Residues 195 Isoelectric Point 5.26
    Sequence mgtdkfnnikidkyenlinvlktgdiflcsgnylvsklikkvsesmfshtgiivkwgehtlimesvedd gvrivplehyiknyensnnryngslfiarhellqnvnddsemirnlikvgfsllnsgydkneiaqivar iglgigrhednneyicsefvnecfkkigvefltdsegfifpehiaadhhvlpiaqie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.219
    Matthews' coefficent 2.49 Rfactor 0.192
    Waters 41 Solvent Content 50.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kw0
    1. Structural Analysis of Papain-Like NlpC/P60 Superfamily Enzymes with a Circularly Permuted Topology Reveals Potential Lipid Binding Sites
    Q Xu, ND Rawlings, HJ Chiu, L Jaroszewski, HE Klock - PloS one, 2011 - dx.plos.org
     

    Protein Summary

    This protein belongs to DUF830 (PF05708) and belongs to the NlpC/P60 superfamily of papain-like cysteine peptidase. This protein represents a variant of NlpC/P60 domain with permuted topology (see Anantharaman and Aravind,  2003). The structure is homologous to 2if6 by New York SG. However, the function (substrate specificity) of the two proteins are likely different. This protein has only a small cavity leads to the catalytic cysteine with a lysine in the pocket, so it could represent a closed form of the enzyme.

     

    Reference:

    Evolutionary history, structural features and biochemical diversity of the NlpC/P60 superfamily of enzymes.

    Anantharaman V, Aravind L. Genome Biol. 2003;4(2):R11. Epub 2003 Feb 3. PMID: 12620121

     

    Figure 1. monomer

    fm11628-monomer.png

    Figure 2. Surface with a possible lysine in the active site

    fm11628-surf.png

    Figure 3. a putative tetramer

    fm11628-tetramer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     fm11628-monomer.png
    monomer with lysine
    124.49 kB21:47, 23 Sep 2009qxuActions
     fm11628-surf.png
    monomer small cavity
    116.52 kB21:47, 23 Sep 2009qxuActions
     fm11628-tetramer.png
    tetramer of fm11628a asu
    185.88 kB21:47, 23 Sep 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch